[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rcon0:AAL02981.1


[Show Plain Result]

## Summary of Sequence Search
   1::103
   1::105  9.7e-29 43.3% 0037222 00372221 1/1   xin/Nqo15-like                          
   1::104  2.8e-27 45.2% 0037054 00370541 1/1   xin/Nqo15-like                          
   1::102  7.8e-27 43.1% 0052857 00528571 1/1   xin/Nqo15-like                          
   1::103


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYVINKQSAAKEIWLSSPVSGPYH
00372221   1/1  lnesefhkladelldlieealeellddldidvelsggvltlefenggtivinkqePlkqiWlasplsGp.
00370541   1/1  ltesefhkladelldlieealeelldeldldadidvelsggvltlefenglgtivinkqePlkqiWlasp
00528571   1/1  llllagglllllllsllsesefhkladelldsleealedlleelsdadidvelsggvltltfenggtyvi


                         -         -         *         -         -         -         -:140
query           FFYEQGEWTNRAGLELMAILTEELNIKFDTRPT-------------------------------------
00372221   1/1  hfdyvngkWidtrdgeellelLeeelsellgeele-----------------------------------
00370541   1/1  vsGpfhFdyvngkWidtrdgeellelLeeelsel------------------------------------
00528571   1/1  nkqeplkqiWlaspvsGpfrFdyvdgkWidtr--------------------------------------