[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rcon0:AAL03106.1


[Show Plain Result]

## Summary of Sequence Search
   1::169
  30::114  7.8e-13 22.4% 0039247 00392471 1/1   drug efflux transporter AcrB TolC docki 
  30::114  1.4e-12 25.9% 0039246 00392461 1/1   drug efflux transporter AcrB TolC docki 
   4::169  2.7e-12 32.5% 0047457 00474571 1/1   drug efflux transporter AcrB pore domai 
   1::169


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDYYAETIMAERLSMLPGVAQIQVYGSQQYAVRVQIDPVKMAVNNIGLDQVSNIISSANVNLPTGALYGT
00392471   1/1  -----------------------------pqlrveldrdklaalglslsdvasalqaanggvpvgtlleg
00392461   1/1  -----------------------------pqlrveldpdklaalgltlsdvanalqaanvqvlggllvgt
00474571   1/1  ---yadlvlrdeLlrvpgVgevqlfGgqe.........................................


                         -         -         *         -         -         -         -:140
query           DIYSSIRAPGQLQNVKEYNELILTYKNGNPLFLKNIGKTIDSVANNKIAAWYRDKPGVILAIQKQPDTTN
00392471   1/1  greylvrvqadpglrlspedlenlvvrtadgalvpLsdvAtvel--------------------------
00392461   1/1  fllggreyevvvradglrlspedlenlvvrtnadgslvpLsdvA--------------------------
00474571   1/1  ............................................dyrllarlngkpavglavllqpg.an


                         +         -         -         -         -         *         -:210
query           TIEIVDSIKEVLPLLRRQIPEGININIMF-----------------------------------------
00392471   1/1  ----------------------------------------------------------------------
00392461   1/1  ----------------------------------------------------------------------
00474571   1/1  alevaeavkalleelekslPegvelvivy-----------------------------------------