[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rcon0:AAL03110.1


[Show Plain Result]

## Summary of Sequence Search
   1::125
   4::125  2.4e-18 32.5% 0037050 00370501 1/1    membrane efflux proteins (OEP)         
   4::125  6.5e-17 32.5% 0050674 00506741 1/1    membrane efflux proteins (OEP)         
   1::125


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPPLKQQRHEQETTLKILVGRIPENIVNGLIYRNKPIDYFPALPVLPKILPSELLEQRPDIKAAEQNLLA
00370501   1/1  ---aeaqlalaraaLarllglppdelllladp.....lllpplpasldglpaealerrpdlraaeaqlea
00506741   1/1  ---aenqlalaraaLaallGlppdal....leladpl.pllplpasldglpalalenrpdlraaeaqlea


                         -         -         *         -         -         -         -:140
query           ADVNLKTIKATYFPQISLTGLLGFGSNKLNTLFTNSAETWQVDGNIAGPIFDFGK---------------
00370501   1/1  aeaeigvaraaflPslslsasygysssslsdlfssgsalllgllgnldtwsvgls---------------
00506741   1/1  aeaeiglaraaflPdlslsasygyssndlsdlfsggsdtwsvglslslPlfdggr---------------