[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rcon0:AAL03216.1


[Show Plain Result]

## Summary of Sequence Search
   1::231
   2::209  5.6e-50 32.8% 0036761 00367611 1/1   like aldolase/epimerase                 
   2::210  4.2e-49 32.2% 0039491 00394911 1/1   like aldolase/epimerase                 
   2::196  3.9e-47 35.1% 0042497 00424971 1/1   like aldolase/epimerase                 
   1::205  1.2e-39 30.7% 0038256 00382561 1/1   like aldolase/epimerase                 
   1::231


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDIKYNLAAAYRIMAYLSLDDHTYTHLSARPKNAVFYYIYPFGLRFEEVTTENLLKVSLDGQILEGEEYQ
00367611   1/1  -keeeelreelaaacrllarlglvegtaGniSvrlpdl..flitPsgvlfgeltasdlvvvdldgnvveg
00394911   1/1  -eeeelreelaaafrllarlglvtgtgGniSvrvpegdlflitPsgvdfgeltasdlvvvdldgnvvegg
00424971   1/1  -deeeelreelaaacrllarlglvegtgGniSvrlpeedllgelvdvselplslelagdlflitpsgvdf
00382561   1/1  mvsmeelalreelaaacrllarlglvegtgGniSvrlpdgdvlggellvlkvlrliplsldlpelapdlf


                         -         -         *         -         -         -         -:140
query           YNKTGYFIHGSIYKTRPDISAIFHYHTPAAIAVSALKCGLLPISQWALHFYDRISYHNYNSLVLDADKQS
00367611   1/1  ...lkpssetplHlaiyrarpdvgavvHtHspyatalsllgrelppltqeaakfflggvpvidyagp..g
00394911   1/1  p.lkpssetllHlaiyrarpdvgavvHtHspyatalsllgrglppltqelakafygdvpvlpyatpgeig
00424971   1/1  geltasdlvvvdldllllldgnvvegg..lkpssetllHlaiyierlrarpdvgavvHtHspaatalsll
00382561   1/1  litpsgvdfgeltasdfenlrlvlvdldgnvvelllglsggrkpssetllHlaiyiarlkrarpdvkavv


                         +         -         -         -         -         *         -:210
query           SRLVTDLKQNYVMLLRNHGAITCGKTIHEAMFYTYHLEQACKTQCLLNSTKEQELIIPSVEICKQTVKDL
00367611   1/1  eeelgeriaealgdrpavLlrnHGllvvGktleeAfllaevleeaaeiqllalalglellllpdeeaek-
00394911   1/1  lalnleegerlaealgkalldypdakavLlrnHGllvwGktleeAvllaelleelaeiqllalalggpll
00424971   1/1  gdglppldqeaakgteladvfygrvpvipyagpg..tlelaeaiaealgdkpavll--------------
00382561   1/1  HtHstyatalsllgdplppihqdalifyltlavyvfgggvpvvpyalpgtpelgeaiaealgdkr-----


                         -         -         -         +         -         -         -:280
query           LSFEEDLGKRDWAAWLRLVKM-------------------------------------------------
00367611   1/1  ----------------------------------------------------------------------
00394911   1/1  ----------------------------------------------------------------------
00424971   1/1  ----------------------------------------------------------------------
00382561   1/1  ----------------------------------------------------------------------