[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rcon0:AAL03659.1


[Show Plain Result]

## Summary of Sequence Search
   1::82
  22::75   1.6e-09 51.9% 0048761 00487611 1/1   ike                                     
  22::76     2e-09 45.5% 0039098 00390981 1/1   ike                                     
  22::72   6.8e-07 47.1% 0045711 00457111 1/1   ike                                     
  22::76   0.00027 30.9% 0052014 00520141 1/1   ike                                     
  22::75   0.00069 29.6% 0045099 00450991 1/1   ike                                     
   1::82


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFILNIFKTNWHKILSESTTSDLSNKNITDEQAKDLAAALKANRSLTSLYLPWNNIGEATFKIINEYLYR
00487611   1/1  ---------------------dLsnnglgdegakalaeaLaknttLtsLdLssNnigdeGakaLaealkk
00390981   1/1  ---------------------dLsgnglgdegakaLaeaLkvnstLrsLdLssndigdegvlaLaeaLks
00457111   1/1  ---------------------dLsgnqitdegalaLlsaleknksLteLdlsgnpisdegllallellkr
00520141   1/1  ---------------------dLsgnklsdlglealakalknplpsLetLdlsgnnltdegllslpells
00450991   1/1  ---------------------dLsgnrltglglealpsalaslpsLreLdLsgnnltdeglkalppells


                         -         -         *         -         -         -         -:140
query           NKTITKKSRKEI----------------------------------------------------------
00487611   1/1  nttLt-----------------------------------------------------------------
00390981   1/1  nttLte----------------------------------------------------------------
00457111   1/1  nk--------------------------------------------------------------------
00520141   1/1  klpsLk----------------------------------------------------------------
00450991   1/1  glpnL-----------------------------------------------------------------