[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rcon0:AAL03713.1


[Show Plain Result]

## Summary of Sequence Search
   1::445
 120::445  1.5e-53 43.5% 0051155 00511551 1/1   connector domain                        
  70::368    2e-42 34.1% 0042471 00424711 1/1   p containing nucleoside triphosphate hy 
   1::119  4.5e-36 47.9% 0051157 00511571 1/1   e-binding domain                        
 214::393  7.9e-35 29.4% 0047547 00475471 1/1   p containing nucleoside triphosphate hy 
 208::375  1.4e-34 31.5% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
 216::390  1.9e-33 27.3% 0050741 00507411 1/1   p containing nucleoside triphosphate hy 
 209::375  2.6e-33 31.3% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
 206::392  1.8e-32 26.5% 0041400 00414001 1/1   p containing nucleoside triphosphate hy 
  90::339    5e-31 32.3% 0049759 00497591 1/1   p containing nucleoside triphosphate hy 
 178::390    1e-30 28.5% 0046711 00467111 1/1   p containing nucleoside triphosphate hy 
 155::399  7.3e-30 27.1% 0051784 00517841 1/1   p containing nucleoside triphosphate hy 
 215::384  4.4e-28 25.7% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
 184::372  6.2e-28 26.2% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
 215::373  4.2e-26 32.7% 0052346 00523461 1/1   p containing nucleoside triphosphate hy 
 212::379  5.5e-26 26.5% 0046551 00465511 1/1   p containing nucleoside triphosphate hy 
 216::368    1e-25 31.4% 0051156 00511561 1/1   p containing nucleoside triphosphate hy 
 216::378  1.9e-25 28.2% 0048180 00481801 1/1   p containing nucleoside triphosphate hy 
 207::382  2.1e-25 28.7% 0047023 00470231 1/1   p containing nucleoside triphosphate hy 
 213::367  5.1e-25 32.4% 0051458 00514581 1/1   p containing nucleoside triphosphate hy 
 211::376  5.9e-25 26.1% 0050423 00504231 1/1   p containing nucleoside triphosphate hy 
 216::379  5.9e-25 27.0% 0050482 00504821 1/1   p containing nucleoside triphosphate hy 
 209::382  1.2e-24 28.4% 0049269 00492691 1/1   p containing nucleoside triphosphate hy 
 214::387  1.4e-24 23.8% 0044740 00447401 1/1   p containing nucleoside triphosphate hy 
 213::386  3.2e-24 26.5% 0053196 00531961 1/1   p containing nucleoside triphosphate hy 
 216::383  4.4e-24 26.8% 0049868 00498681 1/1   p containing nucleoside triphosphate hy 
 185::381  1.1e-23 25.3% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
 213::398  1.1e-23 27.7% 0048426 00484261 1/1   p containing nucleoside triphosphate hy 
 205::374  3.7e-23 27.6% 0051927 00519271 1/1   p containing nucleoside triphosphate hy 
 207::376  5.4e-23 28.8% 0051832 00518321 1/1   p containing nucleoside triphosphate hy 
 206::368  6.5e-23 29.5% 0051448 00514481 1/1   p containing nucleoside triphosphate hy 
 173::344  7.5e-23 30.3% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
 202::369  8.5e-23 27.1% 0051510 00515101 1/1   p containing nucleoside triphosphate hy 
 190::419  1.1e-22 22.4% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
 214::372  1.1e-22 24.8% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
 214::375  1.1e-22 28.2% 0052832 00528321 1/1   p containing nucleoside triphosphate hy 
 212::383  1.2e-22 26.4% 0036958 00369581 1/1   p containing nucleoside triphosphate hy 
 212::378  1.2e-22 27.6% 0044233 00442331 1/1   p containing nucleoside triphosphate hy 
 214::373  1.4e-22 27.9% 0040239 00402391 1/1   p containing nucleoside triphosphate hy 
 214::384  1.5e-22 30.8% 0048113 00481131 1/1   p containing nucleoside triphosphate hy 
 200::370  2.1e-22 27.2% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
 210::372  2.2e-22 30.7% 0052841 00528411 1/1   p containing nucleoside triphosphate hy 
 206::372  2.5e-22 30.7% 0049485 00494851 1/1   p containing nucleoside triphosphate hy 
 213::380  2.9e-22 28.0% 0051704 00517041 1/1   p containing nucleoside triphosphate hy 
 216::377  3.2e-22 28.0% 0052914 00529141 1/1   p containing nucleoside triphosphate hy 
 203::370  3.4e-22 27.7% 0037412 00374121 1/1   p containing nucleoside triphosphate hy 
 211::372  3.8e-22 28.8% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
 212::375  4.7e-22 30.9% 0048154 00481541 1/1   p containing nucleoside triphosphate hy 
 213::378  5.1e-22 32.0% 0050775 00507751 1/1   p containing nucleoside triphosphate hy 
 206::369  5.3e-22 30.8% 0048819 00488191 1/1   p containing nucleoside triphosphate hy 
 214::375  5.3e-22 29.5% 0051831 00518311 1/1   p containing nucleoside triphosphate hy 
 212::380  5.4e-22 26.4% 0052625 00526251 1/1   p containing nucleoside triphosphate hy 
 213::411  5.9e-22 29.7% 0046936 00469361 1/1   p containing nucleoside triphosphate hy 
 213::370    6e-22 27.9% 0039999 00399991 1/1   p containing nucleoside triphosphate hy 
 216::373  7.9e-22 27.7% 0051450 00514501 1/1   p containing nucleoside triphosphate hy 
 210::372  8.2e-22 25.5% 0044990 00449901 1/1   p containing nucleoside triphosphate hy 
 192::384  8.3e-22 26.1% 0043133 00431331 1/1   p containing nucleoside triphosphate hy 
 213::373  8.6e-22 27.9% 0051793 00517931 1/1   p containing nucleoside triphosphate hy 
 214::375  1.4e-21 24.3% 0040315 00403151 1/1   p containing nucleoside triphosphate hy 
 215::371  1.7e-21 30.1% 0052098 00520981 1/1   p containing nucleoside triphosphate hy 
 213::383  2.4e-21 26.5% 0036239 00362391 1/1   p containing nucleoside triphosphate hy 
 211::373  4.1e-21 30.0% 0051472 00514721 1/1   p containing nucleoside triphosphate hy 
 207::390  4.3e-21 24.6% 0037248 00372481 1/1   p containing nucleoside triphosphate hy 
 217::370  4.8e-21 31.4% 0052691 00526911 1/1   p containing nucleoside triphosphate hy 
 208::374  5.5e-21 25.3% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
 165::410  5.7e-21 25.4% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
 212::375  6.4e-21 31.1% 0046392 00463921 1/1   p containing nucleoside triphosphate hy 
 201::373  8.7e-21 26.4% 0051582 00515821 1/1   p containing nucleoside triphosphate hy 
 212::375  1.1e-20 30.9% 0052502 00525021 1/1   p containing nucleoside triphosphate hy 
 212::370  1.2e-20 26.8% 0051461 00514611 1/1   p containing nucleoside triphosphate hy 
 214::372  1.3e-20 27.5% 0051471 00514711 1/1   p containing nucleoside triphosphate hy 
 214::373  1.3e-20 27.2% 0051952 00519521 1/1   p containing nucleoside triphosphate hy 
 211::406  1.5e-20 21.5% 0035786 00357861 1/1   p containing nucleoside triphosphate hy 
 213::373  1.6e-20 24.3% 0049404 00494041 1/1   p containing nucleoside triphosphate hy 
 213::382  1.6e-20 26.6% 0052879 00528791 1/1   p containing nucleoside triphosphate hy 
 213::372  1.8e-20 28.0% 0037045 00370451 1/1   p containing nucleoside triphosphate hy 
 213::376  2.1e-20 27.8% 0052724 00527241 1/1   p containing nucleoside triphosphate hy 
 213::372  2.3e-20 26.8% 0035814 00358141 1/1   p containing nucleoside triphosphate hy 
 213::372  2.4e-20 29.7% 0051104 00511041 1/1   p containing nucleoside triphosphate hy 
 214::373    3e-20 27.4% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
 211::374  3.2e-20 27.2% 0044482 00444821 1/1   p containing nucleoside triphosphate hy 
 216::370  3.3e-20 28.9% 0040747 00407471 1/1   p containing nucleoside triphosphate hy 
 212::369  4.9e-20 30.3% 0052859 00528591 1/1   p containing nucleoside triphosphate hy 
 213::386  5.3e-20 27.3% 0039672 00396721 1/1   p containing nucleoside triphosphate hy 
 213::370  6.1e-20 28.6% 0036153 00361531 1/1   p containing nucleoside triphosphate hy 
 213::374  6.7e-20 25.5% 0049292 00492921 1/1   p containing nucleoside triphosphate hy 
 210::407  7.3e-20 20.2% 0044416 00444161 1/1   p containing nucleoside triphosphate hy 
 214::377  7.7e-20 24.8% 0052501 00525011 1/1   p containing nucleoside triphosphate hy 
 215::370  8.3e-20 26.0% 0036279 00362791 1/1   p containing nucleoside triphosphate hy 
 214::372  1.2e-19 26.2% 0037884 00378841 1/1   p containing nucleoside triphosphate hy 
 214::377  1.9e-19 29.8% 0052785 00527851 1/1   p containing nucleoside triphosphate hy 
 216::373  6.7e-19 27.5% 0037407 00374071 1/1   p containing nucleoside triphosphate hy 
 204::370  1.6e-18 27.9% 0036699 00366991 1/1   p containing nucleoside triphosphate hy 
 211::372    2e-18 27.0% 0051460 00514601 1/1   p containing nucleoside triphosphate hy 
 200::374  2.1e-18 24.7% 0038732 00387321 1/1   p containing nucleoside triphosphate hy 
 199::374  2.8e-18 25.0% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
 209::379  2.9e-18 23.6% 0050792 00507921 1/1   p containing nucleoside triphosphate hy 
 213::373  3.9e-18 25.4% 0049582 00495821 1/1   p containing nucleoside triphosphate hy 
 213::370  5.8e-18 26.4% 0038731 00387311 1/1   p containing nucleoside triphosphate hy 
 212::372  9.3e-18 25.8% 0051462 00514621 1/1   p containing nucleoside triphosphate hy 
 212::372  1.4e-17 24.5% 0052735 00527351 1/1   p containing nucleoside triphosphate hy 
 216::385    3e-17 24.8% 0051648 00516481 1/1   p containing nucleoside triphosphate hy 
 213::370  3.4e-17 27.0% 0052680 00526801 1/1   p containing nucleoside triphosphate hy 
 211::378  5.4e-17 25.9% 0052002 00520021 1/1   p containing nucleoside triphosphate hy 
 216::373  5.8e-17 26.0% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
 211::372  1.5e-16 24.3% 0045559 00455591 1/1   p containing nucleoside triphosphate hy 
 211::373  1.7e-16 27.5% 0035281 00352811 1/1   p containing nucleoside triphosphate hy 
 213::372  3.9e-16 26.0% 0051459 00514591 1/1   p containing nucleoside triphosphate hy 
 211::373  4.8e-16 26.1% 0052528 00525281 1/1   p containing nucleoside triphosphate hy 
 211::379  5.3e-16 25.0% 0052615 00526151 1/1   p containing nucleoside triphosphate hy 
 213::380  7.1e-16 23.3% 0052005 00520051 1/1   p containing nucleoside triphosphate hy 
 210::370  7.7e-16 26.5% 0041234 00412341 1/1   p containing nucleoside triphosphate hy 
 214::371  1.5e-15 22.6% 0051562 00515621 1/1   p containing nucleoside triphosphate hy 
 203::372  5.1e-15 20.4% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
 209::362  1.6e-14 27.6% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
 212::380    9e-14 19.5% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
 218::350    1e-11 29.3% 0041170 00411701 1/1   p containing nucleoside triphosphate hy 
 213::356  6.5e-11 22.2% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
 212::382  2.3e-10 19.4% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
 210::376  3.3e-09 24.4% 0052764 00527641 1/1   p containing nucleoside triphosphate hy 
 213::375    4e-09 24.3% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
 165::335  1.1e-07 21.3% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
 213::275  4.5e-07 32.8% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
 215::275  2.1e-06 30.5% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
 211::335  2.6e-06 22.6% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
 216::368    3e-06 21.6% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
 214::259  7.1e-06 32.6% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
 216::275  1.3e-05 29.3% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
 207::366  1.5e-05 22.9% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
 215::259    3e-05 40.5% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
 215::298  3.1e-05 19.3% 0047844 00478441 1/1   arboxykinase-like                       
 165::332  0.00022 23.8% 0049757 00497571 1/1   p containing nucleoside triphosphate hy 
 214::259  0.00097 23.9% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
 216::302  0.00099 23.3% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
   1::445


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           METIFAQSSAFGKAGVAVFRISGPKSLEVLQLLTGRKDFKSRLMYYQQITVPETKELIDNVMVVYFKSPG
00511551   1/1  ----------------------------------------------------------------------
00424711   1/1  ---------------------------------------------------------------------h
00511571   1/1  ldtiaAlatplgegaiavirvsGpdaleileklllgkllkprlallllllddd.gelldevlvllfkaPn
00475471   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SFTGEDVVEIHTHGSKAISIMLTNALLNIAGIRLAEAGEFTKRAFLNNKFDLTAAEGIADLINAETIMQH
00511551   1/1  -------------------------------------------------ldLtqaeavadlidAetelal
00424711   1/1  skkaldelelvldnadvilevvdardpllsldvrlaellegkprllvlnKaDlldaealalllealslgl
00511571   1/1  sfTgedvvelhlhGglavvklvlelllkl.garlAepGeFtrrAflngk---------------------
00475471   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00497591   1/1  -------------------reelrlvaanvdvvllvvdardplfslnlllrylvlaeaggipvilvln.K
00467111   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KQAIRQASGKLEALYNNWRSQLLKMLSLLEAYIDFPDEDIPDTVLNEVTNTHTILVNTISEYLNDNRKGE
00511551   1/1  klalrqlsGalsklieelreellellalvealiDfpeedlvll..eellekleelleelekllasakrge
00424711   1/1  gnvafksalgglg..lealldlllellkel.................................lellrls
00511571   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00409841   1/1  -------------------------------------------------------------------lsl
00507411   1/1  ----------------------------------------------------------------------
00432181   1/1  --------------------------------------------------------------------sl
00414001   1/1  -----------------------------------------------------------------rrlll
00497591   1/1  iDllddeeleellelldelslgldvvavsaktglgidellell...........................
00467111   1/1  -------------------------------------lgepiqlidedg.glldlldelleilsei....
00517841   1/1  --------------hgegirdlldli..................................delrdlle.r
00405881   1/1  ----------------------------------------------------------------------
00471271   1/1  -------------------------------------------prailelesliksllekllellkrlsl
00523461   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00470231   1/1  ------------------------------------------------------------------elae
00514581   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00492691   1/1  --------------------------------------------------------------------G.
00447401   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00356411   1/1  --------------------------------------------lknlsksyg.......ilkalkdisl
00484261   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------sllssl
00518321   1/1  ------------------------------------------------------------------mssl
00514481   1/1  -----------------------------------------------------------------allls
00495771   1/1  --------------------------------iDlleeeedlelleellkelesigvdvvlvsakkgall
00515101   1/1  -------------------------------------------------------------pleelllsl
00477011   1/1  -------------------------------------------------eelrklldlidklrdlllsld
00515511   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00378621   1/1  -----------------------------------------------------------glklllrrlsl
00528411   1/1  ---------------------------------------------------------------------s
00494851   1/1  -----------------------------------------------------------------ldllg
00517041   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00374121   1/1  --------------------------------------------------------------gellrlsl
00401211   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00488191   1/1  -----------------------------------------------------------------fllsl
00518311   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00449901   1/1  ---------------------------------------------------------------------k
00431331   1/1  ---------------------------------------------------ledlldlllllllllllsl
00517931   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00372481   1/1  ------------------------------------------------------------------dlsl
00526911   1/1  ----------------------------------------------------------------------
00517691   1/1  -------------------------------------------------------------------lsf
00440861   1/1  ------------------------MpllslgepllelenlsksyggvvalkdislsipkGeildlldell
00463921   1/1  ----------------------------------------------------------------------
00515821   1/1  ------------------------------------------------------------glllllllsl
00525021   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00444161   1/1  ---------------------------------------------------------------------e
00525011   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00366991   1/1  ---------------------------------------------------------------esllkkl
00514601   1/1  ----------------------------------------------------------------------
00387321   1/1  -----------------------------------------------------------glkglllrlkl
00410321   1/1  ----------------------------------------------------------yggllllkdlsl
00507921   1/1  --------------------------------------------------------------------ss
00495821   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00412341   1/1  ---------------------------------------------------------------------l
00515621   1/1  ----------------------------------------------------------------------
00410531   1/1  --------------------------------------------------------------gelknlsl
00480471   1/1  --------------------------------------------------------------------sl
00490731   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00527641   1/1  ---------------------------------------------------------------------l
00414121   1/1  ----------------------------------------------------------------------
00394721   1/1  ------------------------lvslleslelplleklrpvllddvvgreeal.eallealrr.....
00477971   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00468601   1/1  ------------------------------------------------------------------dlsl
00381441   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00497571   1/1  ------------------------aselvqwlldlgildeseilledlenalalllsligaklvkdllll
00475381   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LLRSGLKLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREESSDI
00511551   1/1  llreGlkvv.............................................................
00424711   1/1  lllkkglkvalvGlpnvGKSTLlnaLlgakvaivsdipgtTrdivlgvl...gkklvliDtPGllefase
00511571   1/1  ----------------------------------------------------------------------
00475471   1/1  ---mglkvalvGlPNVGKSTLlNaLtgak.aivanypgtTrdpnlgvvelpdgrldllaelvkpkkivpa
00409841   1/1  elkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdpilgvvlldgrdllllDtPGlidfasep
00507411   1/1  -----lkvalvGlPNvGKSTLfnaltgak.aivanypftTrdpnlgvvevdderldllaelslkpalgvk
00432181   1/1  elkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlgvveldgrklvliDtpGleefa.sg
00414001   1/1  elkmllrvgivGlpNvGKSTLfnaLtgakvaivanypftTldpnlgvvelpderldllaglakpkklvga
00497591   1/1  ........................kglkvvlvGrsgvGKStLlnallgekvakvsdisatlgrgpgttrd
00467111   1/1  .dqpvlvvaivGrpnvGKStLlNaLlgekvgfaivsgvpgtTrdiwmwivvlieldgrpllliDTpGlgd
00517841   1/1  ldldlpkiavvGrpnvGKSsLlnallgrdflpvssgpgTtrptelrlgespellaeflidggekltdlde
00405881   1/1  ----gervglvGrpgaGKSTLlnaltglk.aivsgypgttldpnlgvvelddgrqlvlvDtpGliel..a
00471271   1/1  klk..kglkvalvGrpgvGKStLlnallggdfaevgptpgtTrdikvvtvegkgvkltliDtpGlgd.pa
00523461   1/1  ----a.kvalvGlpnvGKStLlnallgdk.aivsdipgitrdiqtgtle....kltliDtpGllltklle
00465511   1/1  -ekkrllkvalvGlpnvGKStllnallgakfaivedepgitidinlg.veldgkvkltliDtpGlidgap
00511561   1/1  -----lkvalvGlpnvGKStllnallgadfaiventpgttidiklvvvelkgvklvliDtpGlidgalel
00481801   1/1  -----akialvGlpnvGKStllnallgadfaivedtpgttidinlgvveldgvkltliDtpGlidgaseg
00470231   1/1  llsllierlllrdlllelkllkvllvGdpnvGKStLlnrl.....kivsd.pgtTigv.vgtveldgvkl
00514581   1/1  --ke.lkvvlvGrpnvGKssLlnrllggkf.ivsyiptitrdfilktveldgkkvklqlwDtaGqerfrd
00504231   1/1  mkkklrnvaivGhvnvGKsTLlnrLlgelglidkdvaiverergiTidialvilelkgrklnliDtPGh.
00504821   1/1  -----eklrllkvalvGlpnvGKStllnallgakfaivedepgitidinlgtveldgkklvliDtpGli.
00492691   1/1  .lkkllkvvlvGdpnvGKStLlnrllggk..fvsdypgttrdfnvktveldgklvkltlwDtpGqerf..
00447401   1/1  ---kelkivlvGdsgvGKttLlnrllgnk.fivsyiptitvdiltkeveidgkrvklllwDtpGqee...
00531961   1/1  --kkllkvvlvGdpnvGKstLlnrllggkf..vsdypgttgdfivktveldgktvklqlwDtpGqer...
00498681   1/1  -----llkvalvGlpnvGKStllnallgdk.fivsnipgitidpnvgtveldgkvkltliDtpGlid..p
00356411   1/1  elkkgikilllGlsgsGKSTllnrllgle.......ygpTiginegtieidgvkltlwDtgGqesfrk..
00484261   1/1  --kkllkialvGhpnvGKStLlnrltgekv......pgttgaidii.gtveldgvklnliDtpGqedfrs
00519271   1/1  llkkllkvalvGlpnvGKstllnrllggkf...sey.gtTiginfgtveldgvklvlvDtpGqedf....
00518321   1/1  elkkllkvvlvGdpnvGKstLlnrllggkf..vsdypgttvdfnvktveldgkkvklqlwDtpGq.....
00514481   1/1  lllkkllkvalvGlpnvGKstllnrllggkf...sey.gtTidinfgtveldgvklvlvDtpGqedf...
00495771   1/1  dilldil..kgktvalvGpsGvGKStLlNaLlgellattgeipgdggdgrhtTrdvllirle.g...lvl
00515101   1/1  llkkllkvalvGlpnvGKstllnrllggkf..vereptitidi..gtveldgvkltlvDtpGqedf....
00477011   1/1  ..lglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtrrptelrlsetpgltvlvvflelgerldllg
00515511   1/1  ---kgekvlllGlsgsGKSTllnrllglefl.....pgpTigptegtieidgvklqlwDtgGqer.....
00528321   1/1  ---dkllkvvlvGdpnvGKssLlnrllggkf.ivsyiptiltldfivktveldgkkvtllllqiwDtpGq
00369581   1/1  -kkrirnvaiiGhvdvGKsTLlnaLlgalgaivsdvadlalvldllklerergitidiglvsleldglki
00442331   1/1  -kkkllkivlvGdpgvGKstLlnrllgde..fvedyagttgdnivktveldgkkvklnlwDtpGqedfrs
00402391   1/1  ---kelkvlllGlpnvGKstllnrllggdf....depgtTigvnvgtveldgvklqlwDtpGqerfrsl.
00481131   1/1  ---lelkvvlvGdpnvGKssLlnrllggk..fvsdypgttrdfivktveldgklvklqlwDtaGqerfrs
00378621   1/1  llkkglkvllvGlpgvGKstllnrlageef....dtpgttiginfgtveldgvklqlwDtpGqerfrsl.
00528411   1/1  llkkllkvvlvGrpnvGKstLlnrllggkfaivsyiptitldfllgtveldgkkvklvlwDtpG......
00494851   1/1  lelllslldrllllkkkllkvalvGlpgvGKStLlnallgakflakvsptpgttidiklgvl...gvklt
00517041   1/1  --kkllkvvlvGdpnvGKstLlnrllgdkf.ivsyiptitrdfllktveldgklvklqlwDtpGqerfrs
00529141   1/1  -----llkvalvGrpnvGKstLl.rllggk..fvedypgtigdfivgtveldgklvklqlwDtpGqe...
00374121   1/1  llkkllkvvlvGlpnvGKstLlnrllggdf....depgpTiginfgtveldgvkltliDtpGqeefrsl.
00401211   1/1  elkrglnvgivGhvgaGKSTLlnaLlgllldtlkgelergitikigaasllldklaivsdtpgttldpil
00481541   1/1  -glkkllkvvlvGdpnvGKstLlnrllggv..fvsdypgttgdfivktveldgklvklqlwDtpG.....
00507751   1/1  --dlkllkvvlvGdpnvGKssLlnrllggk..fvsdyppttgdfivktveidgklvklqlwDtaG.....
00488191   1/1  lrrlslllkrllkvalvGlpgvGKStLlnallgakflakvsptpgttrdik..tveldg.kltliDtPGl
00518311   1/1  ---gelkvvlvGdpnvGKssLlnrllggkf..vedypgttgdtilktveldgklvklqlwDtpG......
00526251   1/1  -kdkllkvvlvGdpgvGKstLlnrllggef.iveyiptitvdflvktveldgktvklqlwDtaGqerfrs
00469361   1/1  --MkkripkiaivGhpnvGKsTLlnrllgakfaigyigtvgndpgttrldsleeerergitidsglvkfe
00399991   1/1  --kkelkvvlvGdpgvGKstLlnrllgge..fvedypgttgdflvktveldgktvkltlwDtpGqeefrs
00514501   1/1  -----lkvvlvGrpnvGKstLlnrllggkf.ivsyiptitldfllktveldgkevklqlwDtpGqerfrs
00449901   1/1  kkkkllkillvGdsgvGKStLlnrllggk.fivsyiptitvdiltktveldgkkvkltlwDtpGqee...
00431331   1/1  llkrilniaiiGhvdaGKsTLlnallgltgaiseagavklgkealelgkgslllalvldsldeErergiT
00517931   1/1  --kkllkvalvGlpnvGKstllnrllgdkv...sdepgtTidinfgtveldgvkltlvDtpG........
00403151   1/1  ---kglkivlvGdsgvGKTtLlnrllgde.fpvsyiptigvdfyvktveidgkklvkltlwDtaGqerfr
00520981   1/1  ----glkvvlvGdpnvGKstLlnrllg.gv.fvsdypgttgdfivktveldgkkvklqlwDtpGq.....
00362391   1/1  --krirnvaivGhvdvGKtTLlnaLlgllgaivgdvallalvldslkeerergiTidigavtletdgrli
00514721   1/1  lskkelkvvlvGdpnvGKssLlnrllggk..fvsdypgttgdnilktveldgklvklqlwDtpGq.....
00372481   1/1  llkrirnvaivGhvdaGKsTLlnaLlgalgaiveagevklalvldsleeerergitidsgavsletdgrk
00526911   1/1  ------rkvalvGlpnvGKStLlnrllgak...vse.pgtTiginfgtvelkdgklvkltliDtpG....
00517691   1/1  elkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdggtlllllgllsfllalvldslplerergit
00440861   1/1  ellk.....eldgsllnvalvGpsGsGKStLlnaLlgllkpdegvilvggk.gvTrdivlytle.dgvkl
00463921   1/1  -l.kllkvvlvGdpnvGKssLlnrllggk..fvsdypgttrdfivktveldgklvklqlwDtpG......
00515821   1/1  elkkllkvalvGlpnvGKstLlnrllgakf..vsrgp..TiginlgtveldgvkltlvDtpG........
00525021   1/1  -eldkllkvvlvGdpnvGKssLlnrllg.dv.fvsdypgttgdflvktveldgklvklqlwDtpG.....
00514611   1/1  -lkkllkvvlvGdpgvGKttLlnrllggef.iveyiptigvdfltktvevdgkkvklqlwDtaGqerfrs
00514711   1/1  ---kelkvvlvGdpgvGKtsllnrllgde.fiveyiptigvdfltktvevdgktvklqlwDtaGqerfrs
00519521   1/1  ---kelkilllGlpnvGKstllnrllgeef....dkpgpTrgvnvgtveiggvkfrlwDtgGqrrfrk..
00357861   1/1  kkdklfkillvGdsgvGKTtLlnrllgdef.lveyiptigidfytktveidgkkvklqiwDtaGqerfrs
00494041   1/1  --kkeikilllGlgnvGKttllnrllggef....depgpTigvnvttftlkgvklqlwDtgGqerfrsl.
00528791   1/1  --kkkllkvvlvGdpnvGKstLlnrllggk..fvsdypgttrdfnlktveldgklvklqlwDtpG.....
00370451   1/1  --kkllkillvGdpgvGKstLlnrllgde.fiveyiptitvdfltktveldgklvklqlwDtaGqerfrs
00527241   1/1  --mselkllkvvlvGrpnvGKstLlnrllggk..fvedypgttgdfllktveldgklvklqlwDtpG...
00358141   1/1  --kkelkvllvGdsgvGKstLlnrllgge..fvedyapttgdditktveldgkkvkltlwDtaGqer...
00511041   1/1  --ekkllkvvlvGrpnvGKstLlnrllggkf..vedypgttgdfllktveldgkkvklqlwDtpG.....
00515531   1/1  ---kgekvallGlsgsGKSTllnrllglefa.....ygpTigptsgtieidgvklqlwDtgGqerfrs..
00444821   1/1  elkkllkvllvGlpgvGKttllnrllggefai....ygptiginfgtveldgvklqlwDtaGqerfrsl.
00407471   1/1  -----lkvllvGlpnvGKsTLlnrllgdkv....dkpgtTiginlgtveldgvkltlvDtpGqerfrsl.
00528591   1/1  -sallllllelkkllkvalvGlpnvGKstLlnrllggkf...sey.gtTiginfgtveldgvkltlvDtp
00396721   1/1  --krllnvaivGhvdvGKSTLlnrLlgdsgaiveagtvkdgkvlallgkgsfllllvldsldeerergit
00361531   1/1  --kkllkivlvGdpgvGKstllnrllgne..fvedypgttgdlivktveldgkkvklnliDtpGqeefrs
00492921   1/1  --ekkirnvaivGhvnaGKtTLlnrLlgekldilseerergitidsaattleldgrdlllllllgkllll
00444161   1/1  kkdklfkillvGdsgvGKttLlnrllgde.fiveyiptigvdfytktvevdgktvklqlwDtaGqer...
00525011   1/1  ---kelkvvlvGdpgvGKssLlnrllgge..fvedylpttgddftktvevdgktvklqiwDtaGqerfrs
00362791   1/1  ----elkilvvGdsgvGKttLlnrllgge.fiveyiptigvdfytktvevdgkkvkltlwDtaGqerfrs
00378841   1/1  ---kelkillvGdsgvGKstLlnrllgde.fiveyiptigvdvytktveidgkkvklqlwDtaGqer...
00527851   1/1  ---lelkvvlvGdpnvGKstLlnrllggkf..vsdypgttgdnilktveldgklvklqlwDtpG......
00374071   1/1  -----lkkkrirniaivGhvdaGKtTLlnaLlgtlgaiseaglvkllkeagelgkgslllaavldsleee
00366991   1/1  elkkllkillvGlpgvGKTtllnrllggef....eeyvptiginfvtveikgvklqlwDtaGqerfrslw
00514601   1/1  lkkkllkivlvGdsgvGKTsLlnrllggef.iveyiptigvdfytktvevdgkkvklqlwDtaGqerfrs
00387321   1/1  elkkllkillvGlpgvGKTtllnrllgdefve....ygptiginfvtvdlkgvklqlwDtaGqerfrsl.
00410321   1/1  elkkglkilllGlngaGKTTllnrllggefp....eygptiginvgtveldgvklqlwDtaGqerfrsl.
00507921   1/1  kkkkllkivlvGdsgvGKtsLlnrllgde.fiveyiptigvdfltktievdgkkvklqlwDtaGqer...
00495821   1/1  --akelkvlllGlsnvGKttllnrl.....kfvety.pTigvnf.ktveidgvklqiwDtaGqer.....
00387311   1/1  --kkllkillvGdsgvGKtsLlnrllgge.fiveyiptigvdfltktvevdgkkvklqlwDtaGqerfrs
00514621   1/1  -lkkllkvvlvGdsgvGKtsLlnrllggef.iveyiptigvdfytktvevdgkkvklqlwDtaGqerfrs
00527351   1/1  -kdkllkivlvGdsgvGKttllnrllggef.iveyiptigvdfltktieldgkkvklqlwDtaGqer...
00516481   1/1  -----lkllelkrirniaiiGhvdaGKsTLlnrLlgetgaidedlllklevlakklgevddglllaivld
00526801   1/1  --kkelkvvllGdsgvGKtsLlnrllggef.iveyiptigvdfytktvevdgkkvklqlwDtaGq.....
00520021   1/1  lkkkllkivvvGdsgvGKttLlnrllggkf.ieeyiptigidfytktvevdgkkvklqiwDtaGqerfrs
00513761   1/1  -----kiiaivGkgGsGKTTllnklaglladggkvlvidlDparanlpeqlgidirdlidletvmelglg
00455591   1/1  kkdkllkilvvGdsgvGKttllnrllgge.fiveyiptigidfytktvevdgkkvklqlwDtaGqer...
00352811   1/1  lekkelkilllGlgnvGKsTllnrllggef.....ergpTiginvetfeidgvkftiwDtgGqrdfrklw
00514591   1/1  --kkllkvvllGdsgvGKTsLlnrllggef.iveyiptigvdfytktievdgkkvklqiwDtaGqerfrs
00525281   1/1  kkdkllkvvlvGdsgvGKTsLlnrllgge.fiveyiptigvdfytktvevdgkkvklqlwDtaGqerfrs
00526151   1/1  elkkllkvvllGdsgvGKTtllnrll.ggkfieeyiptigvdfgtvtleledlylklvlvdgknvklqlw
00520051   1/1  --psrkelklvvvGdsgvGKTsLlnrllggkf..ekyvptvgvdyl.ktvevdgklvrlqlwDtpGqerf
00412341   1/1  kkkkllkillvGdsgvGKtsLlnrllgge.fiveyiptigvdfltktvevdgkkvklqlwDtaGqerfrs
00515621   1/1  ---kelkvlllGlsgvGKTtllnrllggef...leeygpTigvnfvtvdlkdvklqlwDtaGqer.....
00410531   1/1  elkkglkillvGlngvGKTtllkrlaggefv....dygptigvnfktvevdgvklviwDtaGqerfrsl.
00480471   1/1  eikkgekvaivGpsGsGKSTLlnaLagl.lspts.vpettrdfilgeilldgkdltlvdtpgiargrlkl
00490731   1/1  -dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDpyrpaadellgvlaeelgldvll
00411701   1/1  -------kfslelllalmldlerirniaiiGhvdaGKTTLterLlyytg.iiseagevdltvtDtledEr
00448931   1/1  --LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarlaareqlgivfqdpglt
00475371   1/1  -ikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDirrpsarellgllgellgldvlvgargg
00527641   1/1  kkkkllkivllGdsgvGKTsllnrllggef.veeyiptigvdfytktievdgknvklqlwDtaG......
00414121   1/1  --kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeilidgqlledlgvlavrlgigyvpqtl
00394721   1/1  ..gpprnvlLvGppGvGKTtlakalakelaag............sgpilldgvpvvrldlsells.vsdl
00477971   1/1  --hkgelvvlvGPsGaGKsTLlnaLlgllptsgvisvsgttrpprpgevd..gvgyvfqsrelfp-----
00493171   1/1  ----mgklivllGpsGaGKsTlaklLaeklglivlsvgdttrepregevd..gvdyvfvsgelfk-----
00451571   1/1  MsikkgeiiaivGppGsGKsTlaklLakllglivldgddllreaiglvtqdgelllelidegilvpdeiv
00512891   1/1  -----evilltGppGvGKTTlakalagelgakfgsvsltgrdvrsarrgigyvfqtveellgllaelvgl
00493431   1/1  ---kGelivllGpsGaGKsTllkllagllgptsgvisvggttreprpge---------------------
00480441   1/1  -----rlivllGpsGaGKsTlaklLaellpglivisvgdttrepregevl..gvdyvfvdrelfe-----
00468601   1/1  evkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyraaaaerlgigavpqdvplfpsltvl
00381441   1/1  ----GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprlgev---------------------
00478441   1/1  ----aevlalhgvsldingegvlivGpsGsGKStlalaLaglGailvdd.dlvllelrgrdilmvfqppa
00497571   1/1  vlkylpsllslldvlrpkvdfddiileeakeelllellelplklpelfkrlglkapkrrgvlLyGppGtG
00475381   1/1  ---mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrlavlsr---------------------
00469161   1/1  -----llIvieGppGsGKsTlaklLaerlgltglsv.lltredgfgtplgelirelllegfqdlilvpdl


                         -         *         -         -         -         -         +:350
query           IEQEGIKRAINSAKTADIKIIMFDAEKLDSSINEDIINLIDENTITIINKIDLIEASKIFSIENKYKCLR
00511551   1/1  ......................................................................
00424711   1/1  leglgkklverflryleeadlvllVvdasdglseq........gkpvivvlNKiDlleaeel.eelkkll
00511571   1/1  ----------------------------------------------------------------------
00475471   1/1  pivlvDtpGlieg.asegeglg.nqflaaireadvilhvvdasegltivhveglvdplrdieiillelil
00409841   1/1  tnlldleiieallraleeadvvllvvdadrglleqdlellelllelgkpvilvlNKiDlldaeellleev
00507411   1/1  pkkivpakivlvDtpGlikg..aslgeglgnqflaaireadvillVvDasegltliihvegsvdPvedie
00432181   1/1  gekqrvalalallreadvlllvvdadeptsfldlellellrelllagkpvilvlnKiDlldareelakll
00414001   1/1  pvvlvDtpGlie.gaslgeglg.rqflaaleeadvilhVvdasdplgiilvvnkvdpledieiisaelgl
00497591   1/1  iilikldrg...llliDtPGiref..glldeeaveltllylegadllllvvdathg.fe-----------
00467111   1/1  tek.edekelvkiallallladvvllvvd..ggiteqdlellklllelgkplilvlnKwDllekeeleel
00517841   1/1  lrkeieeatdallgpgkgfsfdtieleielpdlpnltlvDtPGlgsaavgdqpeeleeafraltleylre
00405881   1/1  slgeglvrqalealeradvillvvdasdplldqpvellsggekqrlalarallgkpvilvlNKiDeptne
00471271   1/1  slqeefralv.lrylrlrgadavllVvdatdpglfeqdlellkellelfgelagvpiilvlNKiDlldae
00523461   1/1  galldllerflrslllsylrgadvvllvvdatdlesfesvllllglkeqllellkllellgvpiilvlnK
00465511   1/1  ellqedfralvlrylrgadgvllvvdatd.lleqllelleellelgvpiilvlNKiDlldarevsleele
00511561   1/1  qerflslrvlrylrgadvvllvvdatdglfeqleellellrgvpiilvlnKiDlldarellelllalllg
00481801   1/1  lqedfrslllrylrgadvvllvvdatdglleqdlellellrelgvpiilvlNKiDlldvlleeleellke
00470231   1/1  qlwDtaGq........erfr.sltlrylrgadavllVvDasdydlvllepdsferleewleelrellanp
00514581   1/1  slrely........lrgadvvllvvdatdgesfedlkkwleellellklagvpiilvgnKiDllearevs
00504231   1/1  ........edfsslvlralrvadgallvvdatdgvtpqtlevlllllllgvpiivvlNKiDlvdadrlee
00504821   1/1  dgaselqedfrkltlrylrgadvvllvvdatdglfeqtlellellrellpgvpiilvlNKiDllddrevl
00492691   1/1  rslrklyyrgaleailllllglllleleeadvvllVvdatdresfeeldlellellrellpgvpiilvgN
00447401   1/1  ......frsllelylrgadgvllVvdatdpesfenlkkwleellellgllllagvpiilvgnKiDlldre
00531961   1/1  ......frslrllylrgadvvllVvdatdgesfedlleelleelrellpgvpiilvgNKiDlldarelle
00498681   1/1  aslqedfrslllrylrgadvillvvdatd.lsfedleklleelrellpellgvpiilvlNKiDlldaeel
00356411   1/1  .......lwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenvpiilvlNKiD
00484261   1/1  .....lverylrgfleeadgvllVvdatedregfeeqtkellellrllglllllgvpiilvlNKiDllda
00519271   1/1  .....raltlrylrgadgvllvvdatdresfegveeqleellelllllgipiilvlNKiDlldaldlrev
00518321   1/1  ...erfrslr.llylrgadvvllVvdatdresfeevdeellellrelglgvpiilvgnKiDlldarelle
00514481   1/1  ......rrltlrylrgadgvllvvdatdresfegveeqleellelllllgvpiilvlnKiDlldarelee
00495771   1/1  iDtpGfrdtileniekeeleatfeeireadlvllvidaih.llepdlavlealeeggipvilvl------
00515101   1/1  .....rrltlrylrgadgvllvvdatdresfegveeqleellellrllgvpiilvlNKiDlldaeelrev
00477011   1/1  lvfqdfsllpelielenralagpiagisrdairleielpglpdltlvDtPGlgsvavvdqlsggqkqrva
00515511   1/1  ....frslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlanvpillvlnKiD
00528321   1/1  erf...........ltllylrgadvvllvvdatdgesfedlkkwleellellelagvpiilvgNKiDlle
00369581   1/1  tliDtPGhedflke.........vlrglavadgallVvdategvlpqtrevlllakllgvpniivvlNKi
00442331   1/1  lve.........lylrgadgvllVvdatdresfegvkkwleeilrllplanvpiilvgnKiDllearevs
00402391   1/1  ........tllylrgadgvllVvdasdgdsfeellkwleellelllllgipiilvlNKiDlldalslrev
00481131   1/1  lle.........lylrgadvvllVvdatdresfeeldeelleelrelaagvpiilvgnKiDlldalslll
00378621   1/1  ........tlrylenadvvllvvdasdpdsfeellelleellellllagvpiilvlNKiDlldaallrev
00528411   1/1  ....qerfrslrllylrgadvvllVvdatdgesfedlkkwleellelleagvpiilvgnKiDlldarevs
00494851   1/1  liDtpGlgdl.dviielaerlrdlvreylralrgadgvllvvdatdglfeqdlellklllelgvpiilvl
00517041   1/1  llely.........lrgadvvllvvdatdgesfedlekwleellelleagvpiilvgNKiDlldarevsl
00529141   1/1  ......rfrslrllylrgadvvllvvdatdgesfenlkkwllellellelagipiilvgnKiDllearev
00374121   1/1  ........tlrylrgadgvllVvdasdgdsfeevlelleellellllanvpiilvlNKiDlldareleel
00401211   1/1  gvleldgpkllllDtPGhed.........flkellralaladgallvvdadegeflpqtlevlllllelg
00481541   1/1  .....qerfrslrllylrgadvvllvvdatdgesfeeldeellellrellagvpiilvgnKiDlldarel
00507751   1/1  ...qerfrslr.llylrgadvvllvvdvtdresfedlkkwleeilellelagvpiilvgnKiDllearev
00488191   1/1  gdllviielaslledfrslt.lrylrgadvvllvvdatdglleqtlelleellel.gvpiilvlNKiDll
00518311   1/1  ....qerfrltllylrgadvvllvvdatdresfeglkkwllellellelagvpiilvgnKiDlld.erev
00526251   1/1  lre.........lylrgadgvllvvdvtdpesfedlkkwleellelldsnvpiilvgnKiDllearevse
00469361   1/1  lng..lnliDtPGhed.........frsltlrylrgadgallVvdatdgvsfqtlellelllelgvpiil
00399991   1/1  lre.........rylrgadgvllVvdatdresfeglkkwleeilellllagvpiilvgNKiDlleerevs
00514501   1/1  llely.........lrgadvvllvvdatdgesfedlkkwleellellgagvpiilvgnKiDllearevsl
00449901   1/1  ......frslrelyyrgadavllvvdatdpesfenlkkwleellelldllllagvpiilvgnKiDllere
00431331   1/1  idiaavsfetdgrkitliDtPGhedfike.........virglsvadgallVvdasegvlerllelepqt
00517931   1/1  .qerfrslrllylrgadgvllvvdatdrdsfeglkeqllellelllllgvpiilvlNKiDlldalelrev
00403151   1/1  slre.........lyyrgadgvllvydvtdresfenvlswleelrellgllllegvpillvgnKlDlptn
00520981   1/1  ....erfrslrllylrgadvvllvvdatdresfeevdewllellrelglnvpiilvgnKiDlldarelle
00362391   1/1  tliDtPGhvd.........fvkevlrglrvadgailVvdavegvmpqtrehlllarllgvpkiivviNKi
00514721   1/1  ....erfrslrllylrgadvvllVvdatdgesfeeldewllellrelgpgvpiilvgnKiDlldarelle
00372481   1/1  inliDtPGhedfske.........vlrglavadgallVvdaadgvspqteevlllarllgvpkiivvlNK
00526911   1/1  ......qedfraellrsylrgadgillVvdatdpesgfeeltkellellrelgllagvpliilvlNKiDl
00517691   1/1  idvalarllldgrkilllDtPGhed.........fvkevlralrladgallvvdadegvslpqtrevlll
00440861   1/1  tliDtpGlgd.tklsdeeklilkyl...eeadlvllvid....d.glteldlellkllkelgkpvilvln
00463921   1/1  ....qerfrslrllylrgadvvllvvdatdresfeeldeellellrelgpgvpiilvgnKiDlldarell
00515821   1/1  qedfrslv.lrylrgadgvllVvdatdresfegveeqleellellkllgvpiilvlNKiDlldaeelrev
00525021   1/1  .....qerfrslrllylrgadgvllVvdatdgesfedlkkwleellellelagvpiilvgnKiDlleere
00514611   1/1  lre.........lyyrgadgvllvvdvtdresfedlkkwleellellepnvpiilvgnKiDlpearevse
00514711   1/1  l.........telyyrgadgvllVvdvtdresfenlkkwleellelaedvpiilvgNKiDlldarevsee
00519521   1/1  .......lwllyfedadaiifvvDasdydqvlledelrnrleellelleeilnllllagkpillvlNKiD
00357861   1/1  lrsly.........yrgadgvllvyditdgesfeelkkwleellrlapnvpiilvgnKiDlldareveea
00494041   1/1  ........welyfegadaiifvvdlsdgdsflnldkwlnrleeslellesilnllllanvpillvgNKiD
00528791   1/1  .....qerfrslrllylrgadvvllVvdatdresfedlkewleelleladllagvpiilvgnKiDlldre
00370451   1/1  lre.........lylrgadgvllvvdatdresfedlkkwleeilellpagvpiilvgnKiDlldalslre
00527241   1/1  .......qerfrslrllylrgadgvllVvdatdpesfeglkkwllellellelagvpiilvgnKiDlle.
00358141   1/1  ......frslrelylrgadgvllVvdvtdgesfeelkkwleeilnllpladvpiilvgnKiDlleerevs
00511041   1/1  .....qerfrslrllylrgadgvllvvdatdpesfeglkkwllellellelagvpiilvgnKiDlledre
00515531   1/1  .......lwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenlanvpillvlnKiD
00444821   1/1  ........wllylrgadavllVvdatdgdsfeelkellleilellllagvpiilvgNKiDllealslrev
00407471   1/1  ........wlrylegadavilvvdasdpdsfeelkelleellellllagvpiilvlNKiDlldakllael
00528591   1/1  G........qedfrslr.lrylrgadgvllVvdatdresfegvekqleellellrllgvpiilvlNKiDl
00396721   1/1  idiaavsfetkgrkltliDtPGhed.........frkevirglrvadgailVvdasdgesfagievepqt
00361531   1/1  lre.........rylrgadgvllVvdatdgesfeelkewleeilellpladvpiilvgNKiDllerevle
00492921   1/1  lllslellkqlnliDtPGhed.........fssevlralrvadgallVvdatdgvslpqteevlelllel
00444161   1/1  ......frslrelyyrgadgvllVydvtdresfenlkkwleeilrllpsgvpiilvgNKiDllderevsk
00525011   1/1  l.........telyyrgadgvllvydvtdresfedlkkwleellelldllsnvpiilvgnKiDllderev
00362791   1/1  lre.........lyyrgadgvllvydvtdresfedlkkwleellkllesgvpiilvgnKiDlldarevse
00378841   1/1  ......frsllelyyrgadgillvvdvtdresfeelkkwleeilrlleagvpiilvgnKiDllgrqvlve
00527851   1/1  ....qerfrslrllylrgadvvllvvdatdresfeeldewllellrelgpgvpiilvgnKiDlldalsll
00374071   1/1  rergitidiaavsfetdgrkitliDtPGhvd.........fikevirglsvadgallvvdavegefeagl
00366991   1/1  l.........lylrgadgillVvdatdgdsfeevakwleellnlagladvpillvgnKiDllealsarev
00514601   1/1  lre.........lyyrgadgvllvydvtdresfenlkkwleellelapsnvpiilvgnKiDlpearevse
00387321   1/1  ........wllyyrgadgillVvdatdgdsfeevaklleeilelaglenvpiilvgNKiDlldalllrev
00410321   1/1  ........lllylrgadgvllVvdatdgdsfeevkellleilelaglagvpiilvgNKiDllealgarev
00507921   1/1  ......frslrelylrgadgvllVydvtdresfedlkkwleellellelpdvpiilvgnKiDlldrevse
00495821   1/1  ....frslwllyyrgadaiifVvDlsdrdqvlledelvnsfeevlewleellnnallanvpillvgNKiD
00387311   1/1  lre.........lyyrgadgvllvydvtdresfedlkkwleeilrlldpgvpiilvgnKiDlleerevse
00514621   1/1  lre.........lyyrgadgvilVydvtdresfedlkkwleellellepgvpiilvgnKiDlldarevse
00527351   1/1  ......frslrelyyrgadgiilVydvtdresfenlkkwleellellpsnvpiilvgnKiDlpearevse
00516481   1/1  klelerergitidsaavsfetdgrkinliDtPGhed.........fvkevlrglrvadgallVvdategv
00526801   1/1  ....erfrslrelyyrgadgvilVydvtdresfenlkkwleellelapanvpiilvgnKiDllearevse
00520021   1/1  lre.........lyyrgadgvilvydvtdresfenlkkwleeilellesnvpiilvgnKiDlpearevse
00513761   1/1  pngalvfaleellttldillealelleedydyiliDtpGglelrallalllaiaral....aadeillvd
00455591   1/1  ......frslrelyyrgadgillvydvtdresfeelkkwleeilrllesnvpiilvgnKiDllderevsk
00352811   1/1  il.........yfegadaiifVvdssdydsflnvdkwtnrleealellesillnrllknvpiilvlNKiD
00514591   1/1  lre.........lyyrgadgvilVydvtdresfenlkkwleellelapsnvpiilvgnKiDlldarevse
00525281   1/1  lre.........lyyrgadgvllVvdvtdresfenlkkwleellelleanvpiilvgnKiDllearevse
00526151   1/1  DtaGqerfrslr.........plyyrgadgvilVydvtdresfenlkkwleellelaelpnvpivlvgNK
00520051   1/1  r..............yyrgadgvllvfdlsdpesfenlkkwlkellellglllpgipillvgtK.Dlled
00412341   1/1  lre.........lyyrgadgiilvydvtdresfenlkkwleeilrlldpgvpiilvgnKiDlleerevse
00515621   1/1  ....frslwelyyrgadgvilVvdatdrdsfeevkkwleellelallagvpillvgNKiDlldalslrev
00410531   1/1  ........larylrgadgillvvdatdglsfeevaklleellglaglegvpiilvgnKlDlldalllrev
00480471   1/1  llearraaigivfqdvdllltltvaenlllgldllllellkelkydpvilllnkidllddrllrraeaee
00490731   1/1  garggdlsgglrqrla.rallgdydvliiDtpgt.ldvllelallellkellaelgadvvllvvdat.lg
00411701   1/1  eRgiTikssatslewelieelllelkldidgkgylinliDTPG.........hvdFsseveralrvaDga
00448931   1/1  vlenlalgeleararellellgledydvvliDtagrlrlpselsggqkqrvaiaralaaplppevlllde
00475371   1/1  dlsgglrqr.larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathdldavlka
00527641   1/1  ....qerfrslrplyyrgadgiilVydvtdresfenlkkwleellelldpnvpivlvgnKiDlpdarevs
00414121   1/1  glfpaltvlellalalllredpdlilidsgGqkq...........rlalaralladpdlgellllDeptl
00394721   1/1  vgelegglrglltealalakpsvlflDEidrlldardsesslevlnaLlrlledg---------------
00477971   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00451571   1/1  iellrealeeldadgvildgfprllgqaelllsggkadlvifldaplevlleRll---------------
00512891   1/1  evrgeleellktlikelsggekqrvalarallakpdvlllDEidgldpdvleallelleelkrsgvtvil
00493431   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00468601   1/1  dnlalardlleaa.kaagydvvlidtaglld.ldrlvgelsggqkqrvaiarala....apevllldept
00381441   1/1  ----------------------------------------------------------------------
00478441   1/1  lfpllevrglniaevlel----------------------------------------------------
00497571   1/1  KTllakalakelgrlpfirvn...............................------------------
00475381   1/1  ----------------------------------------------------------------------
00469161   1/1  lvlellaanraglrelikella------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VSVKNNIALSSILKNIENIAENMAGFTETPYITNQRHRNYLQQALSHLTAFSLDNDLVLATEDIRMTARC
00511551   1/1  .......................llssesllltnarhlealekalealeealellelgldlellaedLrl
00424711   1/1  kflglllegepgdavlap----------------------------------------------------
00511571   1/1  ----------------------------------------------------------------------
00475471   1/1  adlellekrleklgklakggvkdllealelllvllelldgglp---------------------------
00409841   1/1  leellkllaelggvpvvpiSaltge---------------------------------------------
00507411   1/1  iietELiladlellekrleklekkaklggkkllltlalkl------------------------------
00432181   1/1  gvpvvevSaktgegvdellealael---------------------------------------------
00414001   1/1  adlellekllealirrpnsgkssllnkllgeerlilskilgt----------------------------
00497591   1/1  ----------------------------------------------------------------------
00467111   1/1  lkelkplllflvrdfapvlfisaltgtglde....lleal------------------------------
00517841   1/1  adtlillvvdasddltesdalkllkeldelgkptilVlnKiDlldegee---------------------
00405881   1/1  ldlellelleelggtvvlvSahdgegldelldai------------------------------------
00471271   1/1  eveleeeiaellalllklgelg------------------------------------------------
00523461   1/1  iDlladaeeveellaellellgl-----------------------------------------------
00465511   1/1  elakklglvpvvevsaktgegvdelleal-----------------------------------------
00511561   1/1  lpvvevsaktgegvdell----------------------------------------------------
00481801   1/1  lglppvvpvsaktgegvdelleallell------------------------------------------
00470231   1/1  llanvpiilvgNKiDl..leelakelglapvf--------------------------------------
00514581   1/1  leellelakelglpvie-----------------------------------------------------
00504231   1/1  vleeleellkllllpldvpivpisal--------------------------------------------
00504821   1/1  leelrellglvpvvevsaktgegvdelfe-----------------------------------------
00492691   1/1  KiDlldarellelllllglllvsleeilelak--------------------------------------
00447401   1/1  vleelaealakelggipvvetSaktgegvdelfealv---------------------------------
00531961   1/1  llellelglvsleellelakelgavpvvetSaktge----------------------------------
00498681   1/1  eelkellkllgipvvevsaktgegvdelleall-------------------------------------
00356411   1/1  lleekiveellellgleykgdrdpeelsggq---------------------------------------
00484261   1/1  reveevleelkeelkalakelglpiglesnflgvvdlllskallflld----------------------
00519271   1/1  leelaellakelgipvvetSaktg----------------------------------------------
00518321   1/1  llellglllvsleealelakelgavp--------------------------------------------
00514481   1/1  vleelaellalllgipvv----------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00515101   1/1  seelaellakllgipvvet---------------------------------------------------
00477011   1/1  larallknpdtlillvedandldtesdalellkelleegkrtivvvtKiDlldkgeevldilrgllipl-
00515511   1/1  lleaklvllllvglfdlldglp------------------------------------------------
00528321   1/1  drevsleellelakelg.ipvietS---------------------------------------------
00369581   1/1  Dlvdaeerleevleelrellkllgllgelvpvv-------------------------------------
00442331   1/1  eeealelakelglpvvetSaktgegvde------------------------------------------
00402391   1/1  leelalelakllgipvfetSakt-----------------------------------------------
00481131   1/1  lllllglrevlleealelakelglvpvietSakt------------------------------------
00378621   1/1  leelalelakllgipvvetS--------------------------------------------------
00528411   1/1  leellelakelglpvietSakt------------------------------------------------
00494851   1/1  NKiDlldeaelevlleelrell------------------------------------------------
00517041   1/1  eealelakelglpvietSaktgegvdelfe----------------------------------------
00529141   1/1  sleellelakelglpvievSaktgegv-------------------------------------------
00374121   1/1  lellellllllvsteealel--------------------------------------------------
00401211   1/1  vkpiilvlNKiDlvdaelleev------------------------------------------------
00481541   1/1  lellellglllvsleealelakelg---------------------------------------------
00507751   1/1  sleealelakelglpfietSaktlgegv------------------------------------------
00488191   1/1  daeeleevveeleelllal---------------------------------------------------
00518311   1/1  sleellelakelglpvietSaktge---------------------------------------------
00526251   1/1  eealelakelglpfietSaktgegvdelfe----------------------------------------
00469361   1/1  vlNKiDlvdadeleeleellkklglplelvpllldllldsllldllllgllsslllellel---------
00399991   1/1  leealelaeelglpvvetSa--------------------------------------------------
00514501   1/1  eellelakelglpvvetSaktge-----------------------------------------------
00449901   1/1  vlleeleelakelglvpfvetS------------------------------------------------
00431331   1/1  revlllalllgvphiivviNKiDlldadpleell------------------------------------
00517931   1/1  leelaealakelgipvietSakt-----------------------------------------------
00403151   1/1  erdvsleealelalelgllpvievS---------------------------------------------
00520981   1/1  llellglllvsleealelake-------------------------------------------------
00362391   1/1  Dlvdaderlelvveellellkklglllelvpvv-------------------------------------
00514721   1/1  llellglglvsleealelakelg-----------------------------------------------
00372481   1/1  iDlldadelleevkeelrellkllgllledvpvvpiSalt------------------------------
00526911   1/1  ldareveelleelreelkkl--------------------------------------------------
00517691   1/1  llllgvpniivvlNKiDlvdaeel----------------------------------------------
00440861   1/1  kiDllkkeelekllkslnkelglkelrrgigyvfqdpnlfpglvvlisaltgegldeltv----------
00463921   1/1  ellellglllvsleellelakelga---------------------------------------------
00515821   1/1  leelaellakelgipvvetSakt-----------------------------------------------
00525021   1/1  vsleellelakelglpvvetSaktg---------------------------------------------
00514611   1/1  eealelakelglpfietSak--------------------------------------------------
00514711   1/1  ealelakelglpvfetSaktge------------------------------------------------
00519521   1/1  lldekllaelledlfpeykglnn-----------------------------------------------
00357861   1/1  lelakelglpffetSAktgegveelfealvklilepkllleklletllllrvllel--------------
00494041   1/1  lleaklleellkllfpeydglnd-----------------------------------------------
00528791   1/1  vlleeleelakelglpvvetSaktgegvdelf--------------------------------------
00370451   1/1  vseeealelakelglpfietSa------------------------------------------------
00527241   1/1  erevsleellelakelglpvvetSak--------------------------------------------
00358141   1/1  eeeglelakelglipfvetSak------------------------------------------------
00511041   1/1  vsleellelakelgipvvetSa------------------------------------------------
00515531   1/1  lleakeraeellellglgdlldk-----------------------------------------------
00444821   1/1  seelalelakllgipvfetSAktg----------------------------------------------
00407471   1/1  lellrlvlleellllalllg--------------------------------------------------
00528591   1/1  leareveellaelelllll---------------------------------------------------
00396721   1/1  rellllarllgvphiivviNKiDlldadeleevlee----------------------------------
00361531   1/1  eeaeelakelglpvvetSak--------------------------------------------------
00492921   1/1  gvpniivvlNKiDlvdadrleevl----------------------------------------------
00444161   1/1  eearelakelglpfvetSAktgegvdelfealvrlllepvlrletlllkslllvall-------------
00525011   1/1  seeealelakelglpfietSAktgegv-------------------------------------------
00362791   1/1  eealelakelglpfletSAk--------------------------------------------------
00378841   1/1  earalakelgiplfetSaktge------------------------------------------------
00527851   1/1  ellsllglrevlleealelakelglvp-------------------------------------------
00374071   1/1  svepqtrevlllalllgvphiiv-----------------------------------------------
00366991   1/1  seeealelakelgipfvetS--------------------------------------------------
00514601   1/1  eealelakelglpffetSaktg------------------------------------------------
00387321   1/1  leelglelakelgipffetSAktg----------------------------------------------
00410321   1/1  seelalelakelgipvvetSAktg----------------------------------------------
00507921   1/1  eealelakelglpfietSaktgegvdelf-----------------------------------------
00495821   1/1  llee...lakklglkvfetsakt-----------------------------------------------
00387311   1/1  eealelakelglpfvetSak--------------------------------------------------
00514621   1/1  eealelakelglpfietSaktg------------------------------------------------
00527351   1/1  eealelakelglpfietSaktg------------------------------------------------
00516481   1/1  epqtrevlllarllgvpriivvvNKiDlvgadeer-----------------------------------
00526801   1/1  eealelakelglpfietSak--------------------------------------------------
00520021   1/1  eealelakelglpfietSAktgegveel------------------------------------------
00513761   1/1  dptsgldaetqleilelllelll-----------------------------------------------
00455591   1/1  eealelakelglpfletSaktg------------------------------------------------
00352811   1/1  lleeksveeilelleyfpdylgl-----------------------------------------------
00514591   1/1  eealelakelglpffetSaktg------------------------------------------------
00525281   1/1  eealelakelglpffetSaktge-----------------------------------------------
00526151   1/1  iDlpdarevseeeaeelakelglpffetS-----------------------------------------
00520051   1/1  ldlrevsleealelakelggvpyfetsakt----------------------------------------
00412341   1/1  eealelakelglpfvetSAk--------------------------------------------------
00515621   1/1  seeealelakelgipvfetSA-------------------------------------------------
00410531   1/1  saelalelakelgikfietSAk------------------------------------------------
00480471   1/1  rieellelvgls----------------------------------------------------------
00490731   1/1  leaadrilvlleglgvpgvvlNkldlvaeg----------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00448931   1/1  ptsgld----------------------------------------------------------------
00475371   1/1  adrilvldlg.givlnkldlvakg........--------------------------------------
00527641   1/1  eeealelakelglpffetSaktgegv--------------------------------------------
00414121   1/1  vlDaasgedlldllkelaeqlgltv---------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00512891   1/1  ttndldeleladriallr----------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00468601   1/1  sgldalae.llellee------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           IGAITGVINVEEILGEIFKNFCIGK---------------------------------------------
00511551   1/1  aleaLgeitGevvvedlLdeiFssF---------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00511571   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------