[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rcon0:AAL03749.1


[Show Plain Result]

## Summary of Sequence Search
   1::1181
   4::260  2.6e-13 20.3% 0048101 00481011 1/1   omain-like                              
   1::238   0.0007 22.3% 0051802 00518021 1/1   omain-like                              
   1::1181


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRPEFIHLRTQSSYSFLESALTIEKVVELASSNKMPAICLADKGNLFGSLEFALCAVKKGLQPIHGVILN
00481011   1/1  ---mrvDlHvHTtaS.dgAvltpeelverAkelGlkaiaiTDHdplsglplalyaaeilrlkekykdgik
00518021   1/1  lkwlrgDlHvHTtyS..DgaltpeelveaakelGldaiaiTDHdtvsglpealetllskllklangllee


                         -         -         *         -         -         -         -:140
query           IKYDIDIFAQILLIAKDETGYKNLLKLSSLTFTKNDRKICDHIDFEDLIEYQEGLIGLCCYTDGIVGKCL
00481011   1/1  ilpGvEidilpd.ggelhllglgldpldy...vilsvhslgyvpldypryteailaaleaggvavlAHpd
00518021   1/1  ylkklleeidkaakklgilvipGvEistlpdg...ghilglgld................yvpelllsld


                         +         -         -         -         -         *         -:210
query           LARNEEQAMLFARKLQEILGDRFYFEIMRHELPEEQFIEDSYIRIAAELAIPLVATNKVLFSEKSMHDAH
00481011   1/1  lillsa...........dleellkaaaelgdalEvntsglrkdllgllypnreilklakelglpvtagsD
00518021   1/1  evialiheaggvavlaHp.gryvrsri.....llkrlleelleaaaeggdalEvnnssl.........ll


                         -         -         -         +         -         -         -:280
query           DVLLCISAGVTKEYLDRKTVSENCYFKSPHEMIELFSDLPSAIQNTVNLRERCYFAAHANPPMLPNFATE
00481011   1/1  aHgpedlgnlelallllreaglelvl.........vlnrtteemlklfll--------------------
00518021   1/1  klakelgllitagsDaHgpedlgrlytg------------------------------------------


                         -         *         -         -         -         -         +:350
query           NISETDLIKKDAKEGLLARLATKFKSENIALENQEALKTEYFARLNYELDIICNMNFAGYFLIVSDFIKW
00481011   1/1  ----------------------------------------------------------------------
00518021   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           SKKEGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMPDFDIDFCQERREEVINYVRS
00481011   1/1  ----------------------------------------------------------------------
00518021   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           KYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELVPFSAVNPVSLEQAMREVPELANAAKGN
00481011   1/1  ----------------------------------------------------------------------
00518021   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           GLYNLDGEAELIKLVIDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDANSDMLIVGYSMKYSEIA
00481011   1/1  ----------------------------------------------------------------------
00518021   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           GLIKFDFLGLQTLTVITDCKKLLKEQGIEVDFNNMTFDDNKTYQMLCKGKGVGVFQFESIGMKDALRRLK
00481011   1/1  ----------------------------------------------------------------------
00518021   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           PDSIHDLIALGALYRPGPMENIPTYIACKHKLQQPDYLHELLQPILEETYGVVIYQEQVQRIAQVLAGYT
00481011   1/1  ----------------------------------------------------------------------
00518021   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           LGAADLLRRAMGKKIKKEMEEQEEIFVKGAIANNISESQAKSIFATVAKFAGYGFNKAHAASYGVISYQT
00481011   1/1  ----------------------------------------------------------------------
00518021   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           AYLKANYPAAFLVACLNLELNNHDKINLFLQEAKDNGIKIIAPNINISEGYFSVKFSDTVIPHSVKPVIP
00481011   1/1  ----------------------------------------------------------------------
00518021   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           RLDRGIQKISKDTVVKPRCDIAGAIIFALGAIKGVTPNFGKLVTDERKARGAFKSITDFIERLPPKSINS
00481011   1/1  ----------------------------------------------------------------------
00518021   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           KLLENLIKSGCFDELHDNRLQLLSSIPKLLSYSTAYHEEQESNQFSLIKVSSLSPTILVSSDYADKNTLA
00481011   1/1  ----------------------------------------------------------------------
00518021   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           FYEFEAMGLFISNHPLTEYQEIFSRLNILNTADLHNNLPDGTNRVNLAGVIQKKDSRMSARGRFVTLVLS
00481011   1/1  ----------------------------------------------------------------------
00518021   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           DPENIFELSIFSEEVLKDYVHLLDVKSLVVVNCDIVKDEGGIKLTAKSFSSIEDAINNKQFELQFYPQNH
00481011   1/1  ----------------------------------------------------------------------
00518021   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1190
query           EELRQIVTLLAARINNEDQSNAKATIYLQSADVKNFVAKITLPEKFLLQGQDFEILKGYSK---------
00481011   1/1  ----------------------------------------------------------------------
00518021   1/1  ----------------------------------------------------------------------