[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rcon0:AAL03819.1


[Show Plain Result]

## Summary of Sequence Search
   1::249
  41::249  1.4e-17 22.6% 0048693 00486931 1/1   like                                    
  40::249    2e-13 18.8% 0046946 00469461 1/1   like                                    
  44::249  1.7e-10 21.1% 0048966 00489661 1/1   like                                    
   1::249


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKLLLIAAASTALLTSGLSFADCDMNSSVDSSTNSSMSSSVENQWYLKLNAGGVIFNKTKPKGADFKLN
00486931   1/1  ----------------------------------------asaggfyvggglgyafldddsd........
00469461   1/1  ---------------------------------------aadwsgfyvggglGyafldddgdtsgngsld
00489661   1/1  -------------------------------------------sgfyvggglgyasld............


                         -         -         *         -         -         -         -:140
query           NIKSNIKSNTGFTGEIGAGYYIMDNLRTDLTIGTVASSHLKKSKTYPDGNSFSVKNKPTIVSVLLNGYVD
00486931   1/1  .......kdsgfggglalGyqfnd.lgveleysysgkdvds.............ngdlsalslllnaryd
00469461   1/1  ........dsgfagglavGynfndvlgvElgysylgkddlsgg.........glngdldalgltlnakyg
00489661   1/1  .....dddddgfglglgygyqfndnvlgleasytytgasdl.........nslgvdldldtlslaaglgy


                         +         -         -         -         -         *         -:210
query           FVDLSMFKVFAGAGVGAAFVKEKIHSKDIKGGVTDTFNGTTKNKTNFAYQLSLGTSFEVAQGVKAELVYS
00486931   1/1  fplndrlspYvgaGvgyarvsvdldg............sdsdsdtgfgyqlgaGveyaltdnlsldagyr
00469461   1/1  ypltdrllpYvgaGvgyarvdldva............gglsdsdtgfgltagaGveyaitpnlslraeyr
00489661   1/1  plnd..klslYggaGvayakvdvdvtss............asvsdtdfgyaygaGveyaltdnlsldaey


                         -         -         -         +         -         -         -:280
query           WRDYGKTKNTTKTINGDKVKFGGTHYKGHNLMAGLRFDM-------------------------------
00486931   1/1  yldigdanf.............dvdldshsvslGvrYrF-------------------------------
00469461   1/1  yldlgddafld...........dtdldlhsvtlGlsYrF-------------------------------
00489661   1/1  ryldld...................dldantvtlgvgYr-------------------------------