[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF06971.1


[Show Plain Result]

## Summary of Sequence Search
   1::85
   1::85   PF12091 0.0% 51.7647058823529  Protein of unknown function (DUF3567) 
   1::85


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQMIYNSDNYCIVEFGADVEHATLASGGYEIVDKNLKREIFLGGLMAETFRADVTRLIESEPSVEEVDEF
PF12091         mqmlYdsdsyavvelapdedaaqlargGyeivDkrakkevyldGslaelfrkqvkaliedePteeevddl


                         -         -         *         -         -         -         -:140
query           LGKFDTVMNNPLVMH-------------------------------------------------------
PF12091         lekyaslaqqPvvlh-------------------------------------------------------