[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF07116.1


[Show Plain Result]

## Summary of Sequence Search
   1::444
 148::314  PF00158 0.0% 59.2814371257485  Sigma-54 interaction domain 
  10::119  PF00072 0.0% 39.0909090909091  Response regulator receiver domain 
 402::442  PF02954 0.0% 46.3414634146341  Bacterial regulatory protein, Fis family 
 171::288  PF07728 0.0% 24.0740740740741  AAA domain (dynein-related subfamily) 
   1::444


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIAMQDGLRVLFVEDEPLVRQATAQSLELAGFSVLALPSAEAAMPHLGADFPGVLVTDVRLSGASGLDLL
PF00158         ----------------------------------------------------------------------
PF00072         ---------vlivdDeplvrellrqalekegyeevaeaddgeealellkekdpDlillDiempgmdGlel
PF02954         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QHCRNAAPGVPVILVTGHGDITMAVQAMREGAYDFIEKPFGADRLTETVRRALERRALELENHALRRELA
PF00158         ----------------------------------------------------------------------
PF00072         lkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvka---------------------
PF02954         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GPAAGTRIIGRSPAIAQVRDLIANVAATDVPVMINGETGTGKELVARSLHALSTRRDQPFIALNCGAVPE
PF00158         -------ligesealkelleqikkvaktdltvlitGesGtGKellAraiheaskrkkkpfvavncaaipe
PF00072         ----------------------------------------------------------------------
PF02954         ----------------------------------------------------------------------
PF07728         ------------------------------dvlLvGppGtgKselaerlaeal.nreveyvqltrdttee


                         -         -         -         +         -         -         -:280
query           SIFESEMFGHEAGAFTGAGKRRVGKLEHASGGTLFLDEIESMPLALQVKLLRVLQEGTLERLGSNTSIPI
PF00158         eLleseLFGhekGaFtGAekekkGlfekadgGtLfLDeigelplelQekLlrvlqegeverlGsekeikv
PF00072         ----------------------------------------------------------------------
PF02954         ----------------------------------------------------------------------
PF07728         dlkgrreiangttslvdsplvraar.........egeilvlDEveraesevlnsLlslleerrlllpegg


                         -         *         -         -         -         -         +:350
query           DVRIIAASKGDMEALVAQGTFRQDLLYRLNVVTIPLPPLRERREDIVPLFEHFMLVAAVRYQRPAPILSE
PF00158         dvriiaatnedleeaveegkfredLyyrlnvvei------------------------------------
PF00072         ----------------------------------------------------------------------
PF02954         ----------------------------------------------------------------------
PF07728         elvkaknd--------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           MQRQQLMQRPWPGNVRELRNAADRLVLGVPEGGHAGGKADPVDESTPLRERMERYERAVIADTLARTGGA
PF00158         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------
PF02954         ---------------------------------------------------leevEkelIeqALertgGn
PF07728         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VSQAADLLQVGKATLYDKIKRYGL----------------------------------------------
PF00158         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------
PF02954         isrAArlLGisRrtLyrKLkky------------------------------------------------
PF07728         ----------------------------------------------------------------------