[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF07164.1


[Show Plain Result]

## Summary of Sequence Search
   1::219
 160::215  PF03861 0.0% 44.6428571428571  ANTAR domain 
  41::140  PF00072 0.0% 23  Response regulator receiver domain 
   1::219


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHRNQAPSMTRRHPPPSAVAPPATTSRSLRILLVRDPHEADPLNVETIRAGLAQAGFTEVQTVDADLRLP
PF03861         ----------------------------------------------------------------------
PF00072         ----------------------------------------eplvrellrqalekegyeevaeaddgeeal


                         -         -         *         -         -         -         -:140
query           DTITASQPDLVIIASESAARDTIEHVCVSTQHAPRPIVLFTDNDDAQRIKAALSAGITAYIVDGLRAERV
PF03861         ----------------------------------------------------------------------
PF00072         ellkekdpDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpee


                         +         -         -         -         -         *         -:210
query           KTVLDVAYARFQLDQQLRAELDATKLKLAERKTVERAKGLLMQARGISEDEAFKRLRSMAMERGIRLVDA
PF03861         -------------------elealraalesRkvIeqAkgiLMerrglseeeAyalLrklAmdqnvsledv
PF00072         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AQRVIDVMA-------------------------------------------------------------
PF03861         Aeaiv-----------------------------------------------------------------
PF00072         ----------------------------------------------------------------------