[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF07169.1


[Show Plain Result]

## Summary of Sequence Search
   1::454
 208::385  PF05193 0.0% 33.3333333333333  Peptidase M16 inactive domain 
 425::450  PF05193 0.0% 42.3076923076923  Peptidase M16 inactive domain 
   1::454


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSLSVMTIASPRLLRRLAGAAFGAAALLAGAVAHAAIPIESWTASTGAKVFFVPSPSIPMLDVNIDFDAG
PF05193         ----------------------------------------------------------------------
PF05193         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SRYDPPGKAGLATLTAALLDKGASAQDGQPARNEAQIADAFADTGADFGGAAGGDRGGIGLRTLTASPER
PF05193         ----------------------------------------------------------------------
PF05193         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EQSLRLAAQLIKSPTYPDAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSATAETVGSIT
PF05193         -------------------------------------------------------------------nlt
PF05193         -------------------------------------------------------------------nlt


                         -         -         -         +         -         -         -:280
query           HDDLVKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQMTIPASEQRIPHPAQQ
PF05193         redlkdfykkhytpdnmvvvivGdvdheelvklaekyfgdlpaskepppkptgfplepselkkpevflnd
PF05193         redlkdfykkhytpdnmvvvivGdvdheelvklaekyfgdlpaskepppkptgfplepselkkpevflnd


                         -         *         -         -         -         -         +:350
query           ASVALGQPAIARGDPDYFPLLVGNYVLGGGGFSSRLTDQVREKRGLTYGVDSYFSPSKQPGPFSVSLQTK
PF05193         ldeeqahvalafpgppiesdpdsialkvlnelLggg.assrLftelrekeglaysvsafldsysdsglfg
PF05193         ldeeqahvalafpgppiesdpdsialkvlnelLggg.assrLftelrekeglaysvsafldsysdsglfg


                         -         -         -         -         *         -         -:420
query           KENTNEALALVREIVAKYVAEGPTDAELRAAKDNLVNGFPLRIDSNRKLLTNVANIGWYGLPLDYLDTWT
PF05193         isatadpekvekaldvileelrrlkengiteeele-----------------------------------
PF05193         isatadpekvekaldvileelrrlkengiteeele-----------------------------------


                         -         -         +         -         -         -         -:490
query           SQINKVTREQVRAAFQRHVHPDAMATVIVGGPEK------------------------------------
PF05193         ----nltredlkdfykkhytpdnmvvvivG----------------------------------------
PF05193         ----nltredlkdfykkhytpdnmvvvivG----------------------------------------