[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF07569.1


[Show Plain Result]

## Summary of Sequence Search
   1::224
 139::220  PF01713 0.0% 51.25  Smr domain 
   1::224


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSHGAKPTSKPPHRMGLHDLATVRDGLKADAERREAERQAAEAAARRAEEEANVFRTSIGQVSNLRDRNR
PF01713         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VEHPVKKPNPEPVQTRLNDKAVLEASLSDEFDVENLLDVDETMSFRRPGIGEDVIKKLRRGEWVPQDKVD
PF01713         --------------------------------------------------------------------lD


                         +         -         -         -         -         *         -:210
query           LHGLRSDEAREALANFLRRSVRNGVRCVRVIHGKGIGSPDKLPVLKGKVRSWLVQKEEVIAFVQARESQG
PF01713         LHgltveeAlealeefldrarskglrtvliitGkGshseggv..LkkavkewLdegrqyeevsafreaep


                         -         -         -         +         -         -         -:280
query           GAGALMVLLRQPKT--------------------------------------------------------
PF01713         rhGgsGalyV------------------------------------------------------------