[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF07698.1


[Show Plain Result]

## Summary of Sequence Search
   1::115
  16::113  PF00254 0.0% 60.6382978723404  FKBP-type peptidyl-prolyl cis-trans isomerase 
   1::115


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQTTPSGLQFEDTVVGSGDEAKAGKHVTVHYTGWLFENGQAGRKFDSSKDRNDPFVFPLGAGHVIRGWDE
PF00254         ---------------gegpkkakegdtVtvhyegkl.ed...gtvfdssysrakpfefkvGsgqvikgle


                         -         -         *         -         -         -         -:140
query           GVQGMKVGGTRRLVIPADLGYGARGAGGVIPPNATLLFEVELLAV-------------------------
PF00254         eglegmkvGekrtltippelaYgekglaggkippnatlvfeve---------------------------