[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF07717.1


[Show Plain Result]

## Summary of Sequence Search
   1::884
  15::564  PF01411 0.0% 56.4007421150278  tRNA synthetases class II (A) 
 663::705  PF07973 0.0% 62.7906976744186  Threonyl and Alanyl tRNA synthetase second addition 
 810::877  PF02272 0.0% 35.3846153846154  DHHA1 domain 
   1::884


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPRRRLRPHNMKVSDIRSKFLQFFESKGHTVVRSSSLVPANDPTLLFTNSGMVQFKDVFLGTDKRPYVRA
PF01411         --------------eirekFldfFekkgHtvvksssvvpendptllfvnAgmaqfkpiflgkekpklkra
PF07973         ----------------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIQYAWELLTKVYQLPADKLWVTVYA
PF01411         vtsQkciRagGkhnDldnVGktarHhTfFeMlGnfsfgdYFkeeaiefawelltkelgldkerlyvtvye
PF07973         ----------------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EDDEAYDIWAKEVGVPADRIVRIGDNKGARYASDNFWQMADTGPCGPCSEIFYDHGPDVWGGPPGSPEED
PF01411         eddeaaelweklvgvpeerilrlgek.......dnfwemgdtgpcgpcseiyydrGeeigkrkakseeea
PF07973         ----------------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GDRYIEIWNLVFMQFNRDEQGTMTPLPKPCVDTGMGLERIAAVLQHVHSNYEIDLFQALIKGAGRETHIA
PF01411         dddrfleiwnlvfmqfnreedgslkpLpkksidtGmglerlvavLqevrsnydtdvfvplieaieeisga
PF07973         ----------------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           DLNQNSLKVIADHIRACSFLIVDGVIPGNEGRGYVLRRIVRRAIRHGYKLGQKTPFFHKLVGDLVAQMGE
PF01411         ayedkdetdealrviaDHvralaflladGvvpsnegrgYvlRrllRravrhakkLglkeaflaklvavvv
PF07973         ----------------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AYPELAEAQSRVVEVLKAEEERFFETIENGMSILDAAVADLKAKGGKVLDGELAFKLHDTFGFPLDLTQD
PF01411         evlgdaypelkekeetveeiieeEeerFakTlerGlklleelikklkk..kktlsgedafkLydtyGfPv
PF07973         ----------------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VAREQEITVDEAAFDAAMTRQREQARAAGKFKMAAGLEYSGEKTVFHGYDALSMDGVRVTALYVDGASVD
PF01411         dltkeiaeekglkvdiegfekameeqrerskkekkekkllekdvealkelkkteeflgyeeleaea.kvl
PF07973         ----------------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           TMQPGQSGVVVLDNTPFYAESGGQVGDQGTLVSGPAVFAVADTTKIQSDVFGHQGTLANGALKVGDTVAA
PF01411         allkdkefveeveegqegvvvLdrtpfYaesGGqigDeGviekegaefkvkdvqkak.gvvvhkgkleeg
PF07973         ----------------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           QVDAVRRARTVRNHSATHLMHKALREVLGTHVQQKGSLVDPDKTRFDFSHNAPLTDAQIRQIEEIVNAEI
PF01411         klkv------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           LSNAPTVAQVMPFDDAVKSGAMALFGEKYADDVRVLSIGTSKELCGGTHVTRTGDIGLFKIVVEAGVAAG
PF01411         ----------------------------------------------------------------------
PF07973         --------------------------------vrvvsiGdvsvelCgGtHvpnTgeIgafkilseesiak
PF02272         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           IRRVEAITGDNALHYLQSLDARLNEAAAALRAQPSELVPRIGQVQDQVRALEKELEKLKSKLASSQGDEL
PF01411         ----------------------------------------------------------------------
PF07973         glrRI-----------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           AAQAVDVKGLKVLAAQLDGADVKTLRETMDKLKDKLQSAAIVLAAVADGKVSLIAGVTADATSKVKAGEL
PF01411         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------
PF02272         ---------------------------------------vvvvfaeedgkikvsaRsskkldvk.g..el


                         +         -         -         -         -         *         -:910
query           VNFVAQQVGGKGGGRPDMAQAGGTDPANLPKALAGVTEWVSAKV--------------------------
PF01411         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------
PF02272         lreaaeklgGkGGGHadaAgasipdgnkleealeale---------------------------------