[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF07796.1


[Show Plain Result]

## Summary of Sequence Search
   1::188
 126::173  PF08281 0.0% 45.8333333333333  Sigma-70, region 4 
 131::177  PF04545 0.0% 29.7872340425532  Sigma-70, region 4 
  15::75   PF04542 0.0% 22.9508196721311  Sigma-70 region 2 
   1::188


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MATDQELSDFLASVERRAFKQAVFAVRDDEAALDIVQDAMIKLAEKYGDKSAAELPPLFQRILQNTIHDW
PF08281         ----------------------------------------------------------------------
PF04545         ----------------------------------------------------------------------
PF04542         --------------lplvrrlarrllgsgadaeDlvQeaflrllraverfdpergvkfsawlltiirnai


                         -         -         *         -         -         -         -:140
query           FRRQKVRNTWVTLFSNLRDEREGDDSDLLDTLEAQAGTEMAESSADKVERAQVMHIIEQEIQRLPTRQRE
PF08281         -------------------------------------------------------alrealaeLperqre
PF04545         ------------------------------------------------------------LasLperere
PF04542         ldalr-----------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AFLMRYWEDMDVAETAAVMGCSEGSVKTHCSRATHTLAQALRARGVRL----------------------
PF08281         ifllryleglsykEIAellgisegtVksrlsRA-------------------------------------
PF04545         vlelrfgeglTleEiGerlgisrerVrqiekrAlrkL---------------------------------
PF04542         ----------------------------------------------------------------------