[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF07810.1


[Show Plain Result]

## Summary of Sequence Search
   1::334
 160::286  PF00107 0.0% 38.0952380952381  Zinc-binding dehydrogenase 
  28::103  PF08240 0.0% 34.2857142857143  Alcohol dehydrogenase GroES-like domain 
 172::191  PF08240 0.0% 35  Alcohol dehydrogenase GroES-like domain 
   1::334


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKAIEIREYGAPEVLQETQRPDPEPKAGEILIRVAAAGINRPDVFQRTGNYPVPPGASDLPGLEVAGVVV
PF00107         ----------------------------------------------------------------------
PF08240         ---------------------------gevlvkvkaaGiCgsDlhivkgekelevklplilGhEivGive
PF08240         ---------------------------gevlvkvkaaGiCgsDlhivkgekelevklplilGhEivGive


                         -         -         *         -         -         -         -:140
query           GGDLSHPANRFGLKAGDRVCALVQGGGYAELCTAPIEQCLPVPEGLTDIEAAALPETFFTVWSNVFDRGQ
PF00107         ----------------------------------------------------------------------
PF08240         evgegvkk......lkvGdrvvvepliscgeCe-------------------------------------
PF08240         evgegvkk......lkvGdrvvvepliscgeCe-------------------------------------


                         +         -         -         -         -         *         -:210
query           LGKGPRGAAETLLIQGGSSGIGTTAIQIAKALGFKVFVTAGSDDKCKACESLGADRAINYKTQDFVAEVK
PF00107         -------------------GvGlaavqlAkalGarviavdsseeklelakelGadhvinskdedfvkair
PF08240         -------------------------------vGdrvvvepliscgeCeaCk-------------------
PF08240         -------------------------------vGdrvvvepliscgeCeaCk-------------------


                         -         -         -         +         -         -         -:280
query           ALTEGKGVDVILDMVAGSYLARELSCIADDGRIVIIALLGGGKAEIPLGDILRRRITITGSTLRPRPASF
PF00107         eltggkgvdvviecvgagatfeqalkllapgGrvvvvggtsganvefdlrklllkektiqGsllgn.pee
PF08240         ----------------------------------------------------------------------
PF08240         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KGAIAQALHQNVWPLLASGKIKPVIHKVFPAAQAADAHRLMESSEHIGKIVLTW----------------
PF00107         leealq----------------------------------------------------------------
PF08240         ----------------------------------------------------------------------
PF08240         ----------------------------------------------------------------------