[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF07859.1


[Show Plain Result]

## Summary of Sequence Search
   1::259
  15::184  PF00378 0.0% 36.3095238095238  Enoyl-CoA hydratase/isomerase family 
   1::259


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTAQLLSERVDSTLVLTISNPEARNALHPDIYAASAEALEVAARDDSIRAVILTGADGVFCAGGNLNRLL
PF00378         --------------eikldrpeavNalsaelleeltealekleqdksvkavvltgaekaFsaGaDlkela


                         -         -         *         -         -         -         -:140
query           GNRSQPPSVQADSIEVLNQWIESFHAFPKPIIAAVEGPAAGAGFSLVLACDFVVAASDAKFVMAYVKVGL
PF00378         e..kkpeaeqaqlseevqellskledlekpvvAavnGaalgGGlelalacdiriaadeakfglpevklGi


                         +         -         -         -         -         *         -:210
query           TPDGGGSYEIARMLPRQLASEIMMEGKPVDPARLAHFGIVNRVAAPGQALTEALRIAENLAKESPNAVSG
PF00378         lpgaggtqrlprlvGvskAeeilllgksisaeeAlkvGlvdkvv--------------------------


                         -         -         -         +         -         -         -:280
query           IKSLINHAGTATLTEHLAAERDSFVAALHHKDGGEGISAFLEKRKPNYR---------------------
PF00378         ----------------------------------------------------------------------