[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF07863.1


[Show Plain Result]

## Summary of Sequence Search
   1::179
  29::146  PF01850 0.0% 18.2608695652174  PIN domain 
   1::179


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHTTHTGHDANSSAGPDAGALSVTSAPRVVLDSNIWVDLLVFRDPHVEPIRAALAAGAIAPVIRADCREE
PF01850         ----------------------------vflDTsvlvelll.deeahealekllaed.eelfvsaivlsE


                         -         -         *         -         -         -         -:140
query           LRRVLAYPQFTRFAVDIDAALAEVDRFTTLEPVPTQEDADAIRLPKCKDTDDQKFIELAHFSRAALLVSK
PF01850         llyglkrksaek.aaelaeveillealeilptleeslalaareigkkygllpnDaliaatAkeygiklit


                         +         -         -         -         -         *         -:210
query           DKAVLKLRSRLRRSSGVEVLPPLAFGGWLAAWVPPDDRG-------------------------------
PF01850         tfDedf----------------------------------------------------------------