[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF07913.1


[Show Plain Result]

## Summary of Sequence Search
   1::113
   9::99   PF01521 0.0% 48.3516483516484  Iron-sulphur cluster biosynthesis 
   1::113


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFDSKAKMISMTEKAAKHVARYLERRGKGVGLRVGVKTTGCSGLAYKLEYVDEVLPEDQVFETHGIKVIV
PF01521         --------itlteaAakklkelleleeeekalRlgVkygGcsGfsyglkleneaeeddevleqdgvtvvv


                         -         -         *         -         -         -         -:140
query           DPKSLPYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV---------------------------
PF01521         dekslpylegveldfveelegsgfkfsnp-----------------------------------------