[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF07921.1


[Show Plain Result]

## Summary of Sequence Search
   1::256
  11::179  PF00106 0.0% 27.6729559748428  short chain dehydrogenase 
 183::216  PF00106 0.0% 29.4117647058824  short chain dehydrogenase 
  12::179  PF08659 0.0% 23.2704402515723  KR domain 
 186::214  PF08659 0.0% 31.0344827586207  KR domain 
   1::256


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTTGTPRSTHLYIVTGASRGLGAALVRALLVPGNRVIGVARSRNPELEAEATASGVRVAWHLQDLSQPGP
PF00106         ----------tvliTGGlgglGlalArwLveegarhlvlvsrredapgaaeliaelealgaevtvvacDv
PF00106         ----------tvliTGGlgglGlalArwLveegarhlvlvsrredapgaaeliaelealgaevtvvacDv
PF08659         -----------yLvtGGlgglGlelarwLaergarhlvllsrsaapdeeaeallaelealgaevtvvaaD
PF08659         -----------yLvtGGlgglGlelarwLaergarhlvllsrsaapdeeaeallaelealgaevtvvaaD


                         -         -         *         -         -         -         -:140
query           SAGWLASVLDAVEEAPASITLILNAGVVEPIGPITQLHDSTLVPHLQTNLVTPMTMTGAFIEHTVRFDCP
PF00106         adr....dalaallaeirkelgpldgvvhaagvld.dglleeltperlervlapkvtgawllheltld..
PF00106         adr....dalaallaeirkelgpldgvvhaagvld.dglleeltperlervlapkvtgawllheltld..
PF08659         vadrda....vealleeveaeepplrGvvhaAgvlrdallaemtaedlaavlapKvtGawnLhelladep
PF08659         vadrda....vealleeveaeepplrGvvhaAgvlrdallaemtaedlaavlapKvtGawnLhelladep


                         +         -         -         -         -         *         -:210
query           RKVLAISSGAARNPVPGWSAYCAGKAGLDMFIRSVNTEYASVPEPRTLRAVALAPGVVDTGMQETIRGAD
PF00106         ..ad.lgafvlfSSvagvlgspgqaaYaaakaaldalae---rkelgpldgvvhaagvlddglleeltpe
PF00106         ..ad.lgafvlfSSvagvlgspgqaaYaaakaaldalae---rkelgpldgvvhaagvlddglleeltpe
PF08659         ldf.....fvlfSSiagvlgsagqanyaaanaflDalae------pplrGvvhaAgvlrdallaemtaed
PF08659         ldf.....fvlfSSiagvlgsagqanyaaanaflDalae------pplrGvvhaAgvlrdallaemtaed


                         -         -         -         +         -         -         -:280
query           FAQVQRFRDLKDNEQLASPDDTARRIVAYLARPDFGTTELDDIRKY------------------------
PF00106         rlervl----------------------------------------------------------------
PF00106         rlervl----------------------------------------------------------------
PF08659         laav------------------------------------------------------------------
PF08659         laav------------------------------------------------------------------