[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF07996.1


[Show Plain Result]

## Summary of Sequence Search
   1::397
  34::273  PF02784 0.0% 29.7413793103448  Pyridoxal-dependent decarboxylase, pyridoxal bindin 
 278::392  PF00278 0.0% 22.6415094339623  Pyridoxal-dependent decarboxylase, C-terminal sheet 
  25::245  PF01168 0.0% 27.1794871794872  Alanine racemase, N-terminal domain 
   1::397


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDLTHVTRYIAGRDTREPVCAYLYDLDDLRLRTTRLRAALPEQCALYYAVKANSDAPVLRALLGVADGFE
PF02784         ---------------------------------alaqaflprkvqvvyAvKansdkavlqllaelGlglD
PF00278         ----------------------------------------------------------------------
PF01168         ------------------------dldalrhniaalreaa.r.akllaVvKanayghgavrvakalaag.


                         -         -         *         -         -         -         -:140
query           VASFGEIERVRGVDAEVPIAFGGPGKTDAELEGALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRA
PF02784         caSkgElelvlaagvsperiifanpcksrselrlaleaqvvvvtvdneeeLekvaklapel....elllR
PF00278         ----------------------------------------------------------------------
PF01168         adgfgvarlqEalelrsn....kilvleg..fepeelaalvey.dlvptvdsleqaealskaakeagrpl


                         +         -         -         -         -         *         -:210
query           NPAYGLPGATLQMGGGATQFGIDEALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALA
PF02784         vkpdvdakahkklstgqedsKFGldlekeaeellkaakele.lklvGvhfhvGSqisdleafvkAveear
PF00278         ----------------------------------------------------------------------
PF01168         rvhlkvdtgme.............RlGvepeeaeelaealaalpglrleGlmthfaladepdetereqfa


                         -         -         -         +         -         -         -:280
query           KRLRDLHGLTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVA
PF02784         evfeelakelGveelkiLdvGGGlgvdyte...aeeleeiaevinaaleevfeegvkevtiia-------
PF00278         -------------------------------------------------------------------llt
PF01168         rfreladeleaag.lkplvlslgnSadllla.i.a-----------------------------------


                         -         *         -         -         -         -         +:350
query           EVIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLCGELCTPKDVL
PF02784         ----------------------------------------------------------------------
PF00278         nViavktlresdvksqsdvdvyvndgvfqspdswlidqlfpilplsr........laeeptrkatlaGpt
PF01168         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AREVPVDRLRVGDRIAFTMAGAYGWHISHHDFLSHPHPERVFIGGQP-----------------------
PF02784         ----------------------------------------------------------------------
PF00278         CdsdDviakestlplelkegdllvffdvGAYtealas.nfng----------------------------
PF01168         ----------------------------------------------------------------------