[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF08007.1


[Show Plain Result]

## Summary of Sequence Search
   1::1044
   1::1022 PF00873 0.0% 41.7408506429278  AcrB/AcrD/AcrF family 
 304::500  PF03176 0.0% 24.468085106383  MMPL family 
 862::1028 PF03176 0.0% 19.6319018404908  MMPL family 
 330::487  PF02355 0.0% 22.7272727272727  Protein export membrane protein 
 866::987  PF02355 0.0% 19.8347107438017  Protein export membrane protein 
   1::1044


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAQFFLRRPAFAWVLAILTMVAGLVALNSIPVAQYPAVAPPTVILYADYPGATARTVEDRVTAVLEQQMH
PF00873         iikffikrpifalvlalailllGilsilklPvdalPeiapptvqvstsypGaspevvedtvtqpiEqaln
PF03176         ----------------------------------------------------------------------
PF03176         ----------------------------------------------------------------------
PF02355         ----------------------------------------------------------------------
PF02355         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GIPGLLYIDSSSEAGTATVTIGFRQGTDPQLAQVNVRNRVSQAEPLLPEVVRRGGVYVDQASASPFMYVS
PF00873         gldglkyvsSqSseglssitvtFedgtdidiArqqvqnrlqeaknkLPeevqepgiskiktssseilvla
PF03176         ----------------------------------------------------------------------
PF03176         ----------------------------------------------------------------------
PF02355         ----------------------------------------------------------------------
PF02355         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LISKTGTMSETALADYAAGTVLPMLRRLPGIGKVEAYSAEYALRVWFNPDQLNAYGLTTADVEAAIRARN
PF00873         vtskdgsltktdlrdlaesnikdqlsrveGVgdvqliGgsekavriwldpqklaklgltltdvvsalkeq
PF03176         ----------------------------------------------------------------------
PF03176         ----------------------------------------------------------------------
PF02355         ----------------------------------------------------------------------
PF02355         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GSVTPGQLGGAPSKPGQSYQAVVRPPAPLADPEAFGRIVLRSAADGSAVLLRDVARVEMAAADYRYSSTL
PF00873         nvqvaaGql......egqqeelliraqgrlqsaediekiivk.sqdgskvrlrDvAkvelgaeeeriaat
PF03176         ----------------------------------------------------------------------
PF03176         ----------------------------------------------------------------------
PF02355         ----------------------------------------------------------------------
PF02355         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           NGREAASMGLKLADGANVLATSRTVRDALDEAAKAFPAGVAYDISYDTAHFVQSSISRVLMTLAEATVLV
PF00873         lngkpavllavkklpganaievvkavkekleelketlPegveivvvydttefvrasieeVvktlleaivL
PF03176         -----------------------aveearpleglkvevtGpaa.tladlrdasdr...dlklievvtlvv
PF03176         -----------------------aveearpleglkvevtGpaa.tladlrdasdr...dlklievvtlvv
PF02355         -------------------------------------------------etvgptlgkelaekavlalll
PF02355         -------------------------------------------------etvgptlgkelaekavlalll


                         -         -         -         -         *         -         -:420
query           FLILYLFLGNLRATLIPCIVVPVSLLGTVACLYAFGLSLNVITLFGVVLAIGILVDDAIVVVENVERIMR
PF00873         vvlvlflFLqnlratlipaiavPlsllgtfavlkalglsiNlltlfgLvlAiGlvvDdAiVvvEnverkl
PF03176         ilviLlivyrSlvaallplltvvvsllaalglvlilalllglelstfvlgl.lvvlliavGtDYallLvs
PF03176         ilviLlivyrSlvaallplltvvvsllaalglvlilalllglelstfvlgl.lvvlliavGtDYallLvs
PF02355         alvlilvyvalrFewrva.laavialvhDviitvgvlsllgieldlatvaAlLtiiGYSvndtvvvfdrv
PF02355         alvlilvyvalrFewrva.laavialvhDviitvgvlsllgieldlatvaAlLtiiGYSvndtvvvfdrv


                         -         -         +         -         -         -         -:490
query           EEGVDAFTAASRSMREVSGALLAVTLVLCAVFVPMAFLGSAVGVIYRHFAMTLAISIAFSLFFALSLAPA
PF00873         eeegekpleaalksmkeiegalvaialvllavfvPilflgGveGklfrqfaltivlaillsvlvaltltP
PF03176         Ry.reelaagedreeaviravastgkvvtaaGltvaiamlgLvvarlpv...laqvGvaialGvlvdvli
PF03176         Ry.reelaagedreeaviravastgkvvtaaGltvaiamlgLvvarlpv...laqvGvaialGvlvdvli
PF02355         renlkkkkratleeivnlslnqtltrtiltslttllvvvallifgg...kvlkdfalvllvGllvgt---
PF02355         renlkkkkratleeivnlslnqtltrtiltslttllvvvallifgg...kvlkdfalvllvGllvgt---


                         *         -         -         -         -         +         -:560
query           MCASLLRHGAQPARGPLAWFEHRFTAFTTRYAGWVQRLQQRRLRWLAVYLAMAAVCAVGLWQLPSGFLPE
PF00873         alcallLkarkeekekgffrefnrlfdalerrYekllekvlrhravvllvalllvvgslllfvripkefl
PF03176         vlTllPAllv------------------------------------------------------------
PF03176         vlTllPAllv------------------------------------------------------------
PF02355         ----------------------------------------------------------------------
PF02355         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           EDTGELVIDVELPPGSTQAQTRETIAQLEQWMKQERLPVKTSFALLGWNSGGSGEQRASVFLSLDDWKLR
PF00873         Peedegvlvtsvqlppgvsleqtekvlkqvekilk.ekpevesvfavtGfafagdtagqnsakvfisLkp
PF03176         ----------------------------------------------------------------------
PF03176         ----------------------------------------------------------------------
PF02355         ----------------------------------------------------------------------
PF02355         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           GRENAADVVLARLTKGLEEWPGRGDAQLYPYNGTALPELGSTSGLDMRLVTRLEGGRPSLYAARDKLIER
PF00873         ekerkeeektvealierlrkelekikg...anvellapiqlreletlsgvrlelqvklfgddleaLsear
PF03176         ----------------------------------------------------------------------
PF03176         ----------------------------------------------------------------------
PF02355         ----------------------------------------------------------------------
PF02355         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           AKADPVFAEVRATAGQPVPALDLAIDYRKAESFGVDTEAIHHALAATLGSRYIDELARDGRVRRVILQAD
PF00873         eqllaalkqlpeladvrseqqedepqlqvkidrekaaalGvsiadinetlstalggsyvndfieegrvvk
PF03176         ----------------------------------------------------------------------
PF03176         ----------------------------------------------------------------------
PF02355         ----------------------------------------------------------------------
PF02355         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           APFRMQPEDLARLHVRNAQGQMVSLGAFATLEWGNGEATLERYNGLISVRINADVAPGTSTGTAMTRLES
PF00873         vvvqleedlrsspedlkklyvrnkkgkmvplsavakieeekgpnsierenglrsveisgevaegdslgea
PF03176         ----------------------------------------------------------------------
PF03176         ----------------------------------------------------------------------
PF02355         ----------------------------------------------------------------------
PF02355         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           LVRELGPDYEVRWSGRAFEQQQSGTQAPWLFALSMLFIFLCLVALYESWTLPLAVLAIVPAGLVGAASAV
PF00873         eeavekiakqvklPagvgiewtglseqeqeagnsllllvalalllvflvLaalyeslsdpllvlltvPla
PF03176         ---------------------dlrdasdrdlklievvtlvvilviLlivyrSlvaallplltvvvsllaa
PF03176         ---------------------dlrdasdrdlklievvtlvvilviLlivyrSlvaallplltvvvsllaa
PF02355         -------------------------kavlalllalvlilvyvalrFe.wrvalaavialvhDviitvgvl
PF02355         -------------------------kavlalllalvlilvyvalrFe.wrvalaavialvhDviitvgvl


                         -         -         -         +         -         -         -:980
query           WLRGLPNDVYFKVGVIVIMGLAAKNAILVVEYAEQLRRNGLERVQAATQAARQRLRPVVMTSLAFILGVV
PF00873         lvGallalllrglelsviaqvGlilliGlavkNailivefakelrekeglsleeAileaaklRLrPiLMT
PF03176         lglvlilalllglelstfvlgllvvlliavGtDYallLvsRyreelaagedreeaviravastgkvvtaa
PF03176         lglvlilalllglelstfvlgllvvlliavGtDYallLvsRyreelaagedreeaviravastgkvvtaa
PF02355         sllgieldlatvaAlLtiiGYSvndtvvvfdrvrenlkkkkratleeivnlslnqtltrtiltslttllv
PF02355         sllgieldlatvaAlLtiiGYSvndtvvvfdrvrenlkkkkratleeivnlslnqtltrtiltslttllv


                         -         *         -         -         -         -         +:1050
query           PLAISTGPGAGAQRAVGTGVLGGMLGATILGTLVIPLLYAWIARWSKARATTEPAKAPASEPGA------
PF00873         alaailGvlPLalstGaGselqqplgivvlGGlvtstvLtll----------------------------
PF03176         GltvaiamlgLvvarlp...vlaqvGvaialGvlvdvlivlTll.PAl----------------------
PF03176         GltvaiamlgLvvarlp...vlaqvGvaialGvlvdvlivlTll.PAl----------------------
PF02355         vvallif---------------------------------------------------------------
PF02355         vvallif---------------------------------------------------------------