[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF08055.1


[Show Plain Result]

## Summary of Sequence Search
   1::243
  59::213  PF01625 0.0% 53.2894736842105  Peptide methionine sulfoxide reductase 
   1::243


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDAMTTLQRWTRPTALKLASLAVLMVAAAMWELPAISAEAAVKIPAPAVDEKAGTSHTETAVFAGGCFWG
PF01625         ----------------------------------------------------------ekavlaggCfWg


                         -         -         *         -         -         -         -:140
query           VQGVFQHVRGVTRVTSGYSGGSASNAQYEMVGTGMTGHAESVEIRYDPTQISYGKLLQIFFSVAHNPTQL
PF01625         veavfeklkGVisvevGYaggevenptYeevcsgktghaEaveveydpekvsyeellevffei.hdptql


                         +         -         -         -         -         *         -:210
query           NYQGPDHGTQYRSAIFPRSPVQRSIAEAYITQLDTSKAYRAPIVTRVEDYKGFFPAENYHQDFLVKNPSY
PF01625         nrqgndigtqYrsaifytdeeqkkeaeelieklqke.vkskkivteiepletFypaeeyhqdYleknpkr


                         -         -         -         +         -         -         -:280
query           PYIVINDLPKIGNLKTMFPDVYRNDAVLVSKGG-------------------------------------
PF01625         .yc-------------------------------------------------------------------