[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF08099.1


[Show Plain Result]

## Summary of Sequence Search
   1::358
  65::355  PF01180 0.0% 42.5  Dihydroorotate dehydrogenase 
   1::358


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVPTPRRPWPRPTLVLNALYPLLRPALFSMDAEDAHHFTLNNLMRAKRMGLAGCIGNSIADDPRTVMGVR
PF01180         ----------------------------------------------------------------kvlglk


                         -         -         *         -         -         -         -:140
query           FPNPVGLAAGLDKDGAYIDGLAAFGFGFIEVGTVTPRAQPGNPRPRMFRLPQADALINRMGFNNGGVDAF
PF01180         fknpiglAaGfdkegeeiakllklgfgaieigsvTpepqeGnpkPrvfrlpedrsvlNsiGlnneGldav


                         +         -         -         -         -         *         -:210
query           IRNVQASRWKAEGGVLGLNIGKNADTPIERAADDYLYCLERVYPHASYVTVNISSPNTKNLRQLQGASEL
PF01180         leellkrrkeqee.evgiilskakkt..enavedyvevvrkigrladilelNvSsPntpglrdlqekeel


                         -         -         -         +         -         -         -:280
query           DSLLSTLKAAQQRLADQHKRYVPVALKIAPDLDDDQVRNIGDALVRHKIDGVIATNTTISRDAVKGLPHA
PF01180         kaillkvvkevs........kvpvlvklaPdltdeekkdiadvllelkldgiivtNttvqrnridlksek


                         -         *         -         -         -         -         +:350
query           EEAGGLSGRPVFEASTRVVRALREVIGDALPIIGVGGIFSGADARAKIDAGAQLVQVYSGLIYRGPTLVR
PF01180         nikanktGGlsGkalkdialkvirelykrlkkeipiIgvGGiesgeDalekieaGAslvqvytalvfegp


                         -         -         -         -         *         -         -:420
query           ECASALRR--------------------------------------------------------------
PF01180         kiakk-----------------------------------------------------------------