[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF08260.1


[Show Plain Result]

## Summary of Sequence Search
   1::305
  42::65   PF00528 0.0% 20.8333333333333  Binding-protein-dependent transport system inner me 
 100::292  PF00528 0.0% 21.9101123595506  Binding-protein-dependent transport system inner me 
   1::305


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAGAISRLGGPGAPGAPSAHVQAAQFPHDATGESRWVRYGLITVAVLFLGLFLFIPLASVFYEALRKGVD
PF00528         -----------------------------------------rpliivlsslPsfvlaillvlvfv-----
PF00528         -----------------------------------------rpliivlsslPsfvlaillvlvfv-----


                         -         -         *         -         -         -         -:140
query           TYLAALTEPDAVSAIKLTLTVAAIAVPLNVVFGVAAAWAIAKFDFRGKNLLITLIDLPFSVSPVISGLIY
PF00528         -----------------------------illGilaa...lnrnkkldkllrpliivlsslPsfvlaill
PF00528         -----------------------------illGilaa...lnrnkkldkllrpliivlsslPsfvlaill


                         +         -         -         -         -         *         -:210
query           VLMFGAQGWFGPWLEAHDIKIMFAVPGIVLATIFVTFPFVARELIPLMQAQGSEEEEAAIVLGASGWQTF
PF00528         vlvf...........vilsilghlilpviillllsaapyvrlirraalrslpkdlveaaralGasrwqif
PF00528         vlvf...........vilsilghlilpviillllsaapyvrlirraalrslpkdlveaaralGasrwqif


                         -         -         -         +         -         -         -:280
query           WHVTLPNIRWGLLYGVILCNARAMGEFGAVSVVSGHIRGLTNTMPLHVEILYNEYNFAAAFAVASLLTLL
PF00528         rkvvlPnalppiitglilafggllggavlleflgs.wpGlgtllleailgydyseisnggvlalviavll
PF00528         rkvvlPnalppiitglilafggllggavlleflgs.wpGlgtllleailgydyseisnggvlalviavll


                         -         *         -         -         -         -         +:350
query           ALVTLGIKTLVEIRASREQLEGQPS---------------------------------------------
PF00528         lnlvadilqrll----------------------------------------------------------
PF00528         lnlvadilqrll----------------------------------------------------------