[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF08451.1


[Show Plain Result]

## Summary of Sequence Search
   1::139
  10::121  PF00989 0.0% 33.9449541284404  PAS fold 
  12::125  PF08448 0.0% 33.0275229357798  PAS fold 
  30::117  PF08447 0.0% 29.2682926829268  PAS fold 
   1::139


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTISTNTAAQILEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAA
PF00989         ---------aileslpdpifvvDedgrilyvNaaaeellGlsreevlgkslldliheeddaelaelleql
PF08448         -----------ldslpdalavldpdgrvlyaNaaaaelfgappeellGktlaellpeedaarleralrrv
PF08447         -----------------------------yvsprveeilGyspeel.gkssyedwldlvhpeDrerv.re


                         -         -         *         -         -         -         -:140
query           IDTGKTRLSGKPTLTKAIHKDGRKLFVEMTFALISDANGNVIGSVAVARDVTDKVERERAQSAAGPVSR-
PF00989         leqgeesrageisfkl...rdgrpihlevraspvrdaggeilgflgvlrdi-------------------
PF08448         legeepiefleelll.....pgeerhyelrllPlrdesGevigvlvisrdiTerr---------------
PF08447         aleel.llkkgevysfe...yRirrkdGeyrWveargrvirdengkp-----------------------