[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF08536.1


[Show Plain Result]

## Summary of Sequence Search
   1::404
  44::77   PF01494 0.0% 47.0588235294118  FAD binding domain 
 177::345  PF01494 0.0% 24.6987951807229  FAD binding domain 
  45::83   PF01266 0.0% 44.4444444444444  FAD dependent oxidoreductase 
 134::337  PF01266 0.0% 20.5128205128205  FAD dependent oxidoreductase 
  10::37   PF05834 0.0% 25  Lycopene cyclase protein 
  45::78   PF05834 0.0% 44.1176470588235  Lycopene cyclase protein 
 283::363  PF05834 0.0% 32.8947368421053  Lycopene cyclase protein 
  45::201  PF07992 0.0% 29.3103448275862  Pyridine nucleotide-disulphide oxidoreductase 
  44::86   PF03486 0.0% 32.5581395348837  HI0933-like protein 
  45::81   PF00890 0.0% 48.6486486486486  FAD binding domain 
 275::370  PF00890 0.0% 20  FAD binding domain 
  42::88   PF01946 0.0% 40.4255319148936  Thi4 family 
  46::79   PF00070 0.0% 38.2352941176471  Pyridine nucleotide-disulphide oxidoreductase 
 139::169  PF00070 0.0% 22.5806451612903  Pyridine nucleotide-disulphide oxidoreductase 
  45::77   PF01134 0.0% 45.4545454545455  Glucose inhibited division protein A 
   1::404


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPSARHPPPFTFTSSCLHPRTGYSRPSNHQRGTEMATRTQDFDHDVVIVGASFAGAACALAAARAGLRVV
PF01494         -------------------------------------------tdVlIVGaGpaGlmlallLseaGvrvv
PF01494         -------------------------------------------tdVlIVGaGpaGlmlallLseaGvrvv
PF01266         --------------------------------------------dvviiGgGivGlstAyeLarrglkVt
PF01266         --------------------------------------------dvviiGgGivGlstAyeLarrglkVt
PF05834         ---------iGaaaglvhPaTGYslaralaeadaiaa-------DlvivGaGlAglllAlrlreakpglr
PF05834         ---------iGaaaglvhPaTGYslaralaeadaiaa-------DlvivGaGlAglllAlrlreakpglr
PF05834         ---------iGaaaglvhPaTGYslaralaeadaiaa-------DlvivGaGlAglllAlrlreakpglr
PF07992         --------------------------------------------dvviIGgGpaGlaaakrlarlglkva
PF03486         -------------------------------------------kdviviGgGaAGlmaAisaakrgakVl
PF00890         --------------------------------------------DvvViGsGlAGlaAAleaaeaglkva
PF00890         --------------------------------------------DvvViGsGlAGlaAAleaaeaglkva
PF01946         -----------------------------------------aesDvvivGaGssGltaayylakkdlkva
PF00070         ---------------------------------------------vvvvGgGyiGlElAaalaklgkkVt
PF00070         ---------------------------------------------vvvvGgGyiGlElAaalaklgkkVt
PF01134         --------------------------------------------dviViGgGhAGceAAlaaarlGakvl


                         -         -         *         -         -         -         -:140
query           VLERKTDPGSKLHTTGILVKEAAEQTWLGRAPADCLRRIEKVHLYSPALRSLALAAPGYYFLTTDTPNLM
PF01494         lvekhst---------------------------------------------------------------
PF01494         lvekhst---------------------------------------------------------------
PF01266         llekg.dias..g--------------------------------------------------vdpaklv
PF01266         llekg.dias..g--------------------------------------------------vdpaklv
PF05834         vllidagp--------------------------------------------------------------
PF05834         vllidagp--------------------------------------------------------------
PF05834         vllidagp--------------------------------------------------------------
PF07992         liere..pggtclnrgcipkkllleaaeee......................................el
PF03486         lldkakklgrKilisG------------------------------------------------------
PF00890         vvekeqetgga-----------------------------------------------------------
PF00890         vvekeqetgga-----------------------------------------------------------
PF01946         ilerklsiGGGawlGGql----------------------------------------------------
PF00070         vierrdrll-----------------------------------------------------------ia
PF00070         vierrdrll-----------------------------------------------------------ia
PF01134         Lithkld---------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RWLASELVNHGVDLRLGTSFSQASRSGAGWSVPGVGRTRYLVGADGARSRVAQIAGLGQGNAFLYGVEYE
PF01494         ------------------------------------rakYlvGaDGgrStvrktlgiefegeetvyeagv
PF01494         ------------------------------------rakYlvGaDGgrStvrktlgiefegeetvyeagv
PF01266         kalaraaeelGveiiegtkVtglereggrvsgvrtedgsiradkvvlAaGawssk..llkllgldlpirp
PF01266         kalaraaeelGveiiegtkVtglereggrvsgvrtedgsiradkvvlAaGawssk..llkllgldlpirp
PF05834         ----------------------------------------------------------------------
PF05834         ----------------------------------------------------------------------
PF05834         ----------------------------------------------------------------------
PF07992         dlkeleerkdegievllntgvtdidkakkkvel.adgkaevkydklviAtGakprtlgipG---------
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF00070         kilqkklekngievllntkveeiegsadg-----------------------------------------
PF00070         kilqkklekngievllntkveeiegsadg-----------------------------------------
PF01134         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FAGLQLSDPDALHCFASKHFAPGYIGWVAQNPTGVQAGLALRHAPRRRAAPDIDGFLRRVRHLLGVPEDA
PF01494         ldvlfda.dlsdivegvvlilsaesrgvmviPlesanlerfyvqvearae.keersekfteeevkarlre
PF01494         ldvlfda.dlsdivegvvlilsaesrgvmviPlesanlerfyvqvearae.keersekfteeevkarlre
PF01266         vrgqvlvtepltdelaaavilgpvavldargvfvlpregevlvgttdgrldrgataeessgedvdvdlev
PF01266         vrgqvlvtepltdelaaavilgpvavldargvfvlpregevlvgttdgrldrgataeessgedvdvdlev
PF05834         ----------------------------------------------------------------------
PF05834         ----------------------------------------------------------------------
PF05834         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------aldela
PF00890         ----------------------------------------------------------------aldela
PF01946         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           APTTTRAGLIPCGGPVYPLARDGVLLTGDAAGIVSPVTAGGIHAAWRHGEAVGRAIAAHLRTGAATPEQV
PF01494         avgektldveieevsawevaqrvaeryrkgrvflaGDAaHihpPtgGqGlNtaiqDaynLawkLa-----
PF01494         avgektldveieevsawevaqrvaeryrkgrvflaGDAaHihpPtgGqGlNtaiqDaynLawkLa-----
PF01266         delleaakkllpqlkdaeilrawaGlrpvt.......pdglpvigevpevpglyvat-------------
PF01266         delleaakkllpqlkdaeilrawaGlrpvt.......pdglpvigevpevpglyvat-------------
PF05834         --veeEqgviPvtlggdlpaleqk.vlaiGaaaglvhPaTGYslaralaead....aiaallrlsseslr
PF05834         --veeEqgviPvtlggdlpaleqk.vlaiGaaaglvhPaTGYslaralaead....aiaallrlsseslr
PF05834         --veeEqgviPvtlggdlpaleqk.vlaiGaaaglvhPaTGYslaralaead....aiaallrlsseslr
PF07992         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         dqplveafveaapeavdeleelgvpfsrtedg.pvdlrelGglsatrtlhdaadarretlvtghallarl
PF00890         dqplveafveaapeavdeleelgvpfsrtedg.pvdlrelGglsatrtlhdaadarretlvtghallarl
PF01946         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AEQSAPRFRTKRLLRWAFDHFQSDWAFDVLLHSAPLRWVAERIYFHKRGVAAEI----------------
PF01494         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF05834         aaadlwarerkrq---------------------------------------------------------
PF05834         aaadlwarerkrq---------------------------------------------------------
PF05834         aaadlwarerkrq---------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         lesareagkvdfqerhrade--------------------------------------------------
PF00890         lesareagkvdfqerhrade--------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------