[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF08549.1


[Show Plain Result]

## Summary of Sequence Search
   1::341
  21::126  PF03050 0.0% 22.6415094339623  Transposase IS66 family 
  80::184  PF00665 0.0% 21.9047619047619  Integrase core domain 
   1::341


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIKELPAGVAKVLKRLHHPLDVILLCVRWYVAYSLSLRDLEEMMAERGLAVDHSMVHRWVIKLLPLFEKA
PF03050         --------------------sllahvlvlkyadhlPlyrqaeilarlGveisrstlanwvgrvaellepl
PF00665         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FRRHKRSVSKSWRMDETYLKVRGKWAYLYRAVDKAGNTIDFLLCARRDKVAARRYFEKAIGQNGAPDTVA
PF03050         ydalkaellaspvlhaDETpvrvlkekgkgkkgylWvyvrsdppavlfdyspsRsg--------------
PF00665         ---------elwqiDvtpgripskggkaylltaiddfsrfivaealkdessaetvadlleraverrggve


                         +         -         -         -         -         *         -:210
query           IDKSAANLAALHAVNAHRETPIRIRQRKYLNNIVEQDHRAIKRRARPMLGFKNFRCARILIGGIETMHMI
PF03050         ----------------------------------------------------------------------
PF00665         pkrllsDngseftskafeallkelgirhkftrpyrpqdngkvEr--------------------------


                         -         -         -         +         -         -         -:280
query           AKGRCGDPKAFACPPRSNSIPWFHRPAHSSPPASTNRPYRDRTKGAGAPAFGIQTPFDSSRGSLLLQWQA
PF03050         ----------------------------------------------------------------------
PF00665         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RLMIFDALSPTSRFHSVPEAMHLGKVVVDRGFRRPQSSLRVDTASYRINLAGERHVSRTHQ---------
PF03050         ----------------------------------------------------------------------
PF00665         ----------------------------------------------------------------------