[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF08555.1


[Show Plain Result]

## Summary of Sequence Search
   1::1093
 192::862  PF10101 0.0% 42.9457364341085  Predicted membrane protein (DUF2339) 
 874::1086 PF10101 0.0% 38.5365853658537  Predicted membrane protein (DUF2339) 
   1::1093


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLWILGLIGLIVGASVWGGEGAVVGAAVGAALGWVLRENAQQDALPVRKGEGPSLAQRVSALEREVAELK
PF10101         ----------------------------------------------------------------------
PF10101         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RALGAAGAGYANGAVDSETSDYSETVRSEVPERPPVIPVPASHSAVAATAVSAVPIPVAAAPGSAPAPMS
PF10101         ----------------------------------------------------------------------
PF10101         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RTQVVSHQDVPEIVPVSAASPRPASSSDMPFVVASDIDFAKHLFREALDWLLGGNSVARVGILILFFGVA
PF10101         ---------------------------------------------------igenwlvkvGilvLalGva
PF10101         ---------------------------------------------------igenwlvkvGilvLalGva


                         -         -         -         +         -         -         -:280
query           FLLKYAADNSILPVEFRLAGVCLGAVGLLALGWRLRTRRPGYALAVQGAGVGVLYLTVFAAARLYDLLPA
PF10101         flvkYaieagllppelRlalgalaGlallaaGerlrrrryaafsaaLqGgGlailYltvfaAfhlYellp
PF10101         flvkYaieagllppelRlalgalaGlallaaGerlrrrryaafsaaLqGgGlailYltvfaAfhlYellp


                         -         *         -         -         -         -         +:350
query           GAAFALMVLVCGLAAGLAILQNASVLAVTGSAGGFLAPVLISTGGGSHVMLFSYYALLNTGIFVIAWFRA
PF10101         ptlAfallvlvtaltvvlAllqngplLAvlGllGGfaaPllvstgsgnvvvLfsYyallnagilalawkk
PF10101         ptlAfallvlvtaltvvlAllqngplLAvlGllGGfaaPllvstgsgnvvvLfsYyallnagilalawkk


                         -         -         -         -         *         -         -:420
query           WRVLNLLGFVFTFGIATLWGVLSYKPALLSTTEPFLILFFLLYTGIALLYALRRSVQLTGYVDGTLIFGT
PF10101         kWrwLnllgfvftfliallwlalsyrpelfsstelflilffliflliavlyalerrleaelrklvdltll
PF10101         kWrwLnllgfvftfliallwlalsyrpelfsstelflilffliflliavlyalerrleaelrklvdltll


                         -         -         +         -         -         -         -:490
query           PLAMAGLQAALMRGTPFGMAWSAVAMAAFYFALAAGLLRHRQRLGLLFDALLALGVIFATLAIPLGFDGR
PF10101         fgnplvafvlqaalvsnaeealallalllallylalalllarrarkellllaalllalalafvtlaipla
PF10101         fgnplvafvlqaalvsnaeealallalllallylalalllarrarkellllaalllalalafvtlaipla


                         *         -         -         -         -         +         -:560
query           TTCAVWALEGAGVVWIAMRQQRRLPLWCGLLLQFAAGFAFLAGALGDTEPGAWPVFNARYIGTMLLALAG
PF10101         lsgrwttlaWalegvlllwlgvrqkrrllrafglllqllaallllad.......salavlnsafltglll
PF10101         lsgrwttlaWalegvlllwlgvrqkrrllrafglllqllaallllad.......salavlnsafltglll


                         -         -         -         *         -         -         -:630
query           FFSAWCLLAREQVRTWVPFVQEWGLMVALWGVWWWLGGGVFEIWHWHVEQGWSVQDLLRGWLLFAVLSAW
PF10101         aaaalaaawlllaerssrrerrqglaa..llllaalallllalvvelsda............sltlalaa
PF10101         aaaalaaawlllaerssrrerrqglaa..llllaalallllalvvelsda............sltlalaa


                         -         +         -         -         -         -         *:700
query           LAHLGSRAADWPLAGFPALGLTPVQALLCIASCAVWTGPPLGGSGLLTWPLAFVASWWLLKRQEAAHADT
PF10101         avlllalllrryarrlrwalavlaalvllrlpallsleqaea...lplahwsllayglalallllllrll
PF10101         avlllalllrryarrlrwalavlaalvllrlpallsleqaea...lplahwsllayglalallllllrll


                         -         -         -         -         +         -         -:770
query           WLAPLHTLLFLTLCVLLSDEGYWRLRAFVPEGAWSWAAWTFGHGCLLAVLAGAGLRLHWPVRRFARAYLL
PF10101         ardlaaalwleaaallvlllllvlarellwggdalaaelssweaalltllalalallll.raraarsllv
PF10101         ardlaaalwleaaallvlllllvlarellwggdalaaelssweaalltllalalallll.raraarsllv


                         -         -         *         -         -         -         -:840
query           WAALPLAALLWIWSLASLVSDGAADPLPFVPFLNPLDVGQMLVIVALVLWRRRVLALELASQPRGLEYAA
PF10101         yrlaaylllglaplaalllllllanplllaigdaaplgslpilnplllaylllalallalllrrl.kgvr
PF10101         yrlaaylllglaplaalllllllanplllaigdaaplgslpilnplllaylllalallalllrrl.kgvr


                         +         -         -         -         -         *         -:910
query           LGTVFLWLNAVLLRTLHHHFGVRYAVPEILESLNLQLVFLAGWGAIVLAALWRVREPAVVRVAAFASAPL
PF10101         raellkalrlavllaaallafl-----------weaalltllalalallllraraarsllvyrlaaylll
PF10101         raellkalrlavllaaallafl-----------weaalltllalalallllraraarsllvyrlaaylll


                         -         -         -         +         -         -         -:980
query           VLVMLLWSLYANLTQPGTLLGRIPLLNPLDLIMLLTFGAAVLWWLRAPVAGLPVDLHTRAAGALGAGIVL
PF10101         glaplaalllllllanplllaigdaaplgslpilnplllaylllalallalllrrl.kgvrraellkalr
PF10101         glaplaalllllllanplllaigdaaplgslpilnplllaylllalallalllrrl.kgvrraellkalr


                         -         *         -         -         -         -         +:1050
query           IWLNAVLLRTLHHWQGVPYTLHDLAGSTLVQASLSVFWTVLALLAMLVATRRAVRSLWLVGGGLLAVTVM
PF10101         lavllaaallafllltleirrllhgsglv.......lssgveqaslSvlwlllglalmilGirrksrllr
PF10101         lavllaaallafllltleirrllhgsglv.......lssgveqaslSvlwlllglalmilGirrksrllr


                         -         -         -         -         *         -         -:1120
query           KMFLVDLSFLSGVARIVSFIAVGGLLLLIGYLSPMPPAAKEGV---------------------------
PF10101         laGlallglvvlKlFlvDlsnldgllRivSFiglGl----------------------------------
PF10101         laGlallglvvlKlFlvDlsnldgllRivSFiglGl----------------------------------