[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF08608.1


[Show Plain Result]

## Summary of Sequence Search
   1::405
  76::268  PF02515 0.0% 45.5026455026455  CoA-transferase family III 
   1::405


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSAILQGIKVLDLTRVVAGPWATQNLADMGATVYKIEKPGDGDDTRRMGPFLTDGDGNVTNDSAFFLCCN
PF02515         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RGKQSVTVDISQPEGAELVRQLASHCDVVVENYKAGSLKKYGLDYESIRALRPDIIYCSVTGFGPDGPYA
PF02515         -----valDlkteeGrallkrLladaDVlienfrpgvlerlgldyealrainprliyvsisgfgqdgpya


                         +         -         -         -         -         *         -:210
query           PRPAYDFILQGMAGLMSTCGQPDGTPGAAPMRTAIPLTDILTGLYASVALMGALYHRQATGEGQFIDAAM
PF02515         drpgyDlvvqalsGllsl.t...gepagepPvrvglpiaDiatGllaaaavlaAllerertGeGqrvdvs


                         -         -         -         +         -         -         -:280
query           IDAAVAANGHLALGYHMTGKVPQRAGNSNPVASPSEVFACLDGHVIIAAGNNGQFAALCRVIGCASLIED
PF02515         lleaalallanllllylatgeeprragnrdpaaapyglyrtadGrwvaiaaltdkqwa------------


                         -         *         -         -         -         -         +:350
query           PRFLQNMDRVRNRPVLRETLGERLLNWRLADLIQALEGAGVPCGPINDIDDVFDDPQVRHRELLVRLPHG
PF02515         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           SGVEAPTLRSPLRFSATPVTMTAPPQLGQHTEAALRSELGMSAADVEAFRERGVI---------------
PF02515         ----------------------------------------------------------------------