[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF08673.1


[Show Plain Result]

## Summary of Sequence Search
   1::388
  19::39   PF02687 0.0% 28.5714285714286  Predicted permease 
 206::381  PF02687 0.0% 24.5614035087719  Predicted permease 
   1::388


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVIPLHYIARNVWARRLTTTLTAGGLALVVFVFATMLMLDAGLKRTLVTTGERDNVVLIRKGAETEIQSA
PF02687         ------------------lllllsvlilllavlilllll-------------------------------
PF02687         ------------------lllllsvlilllavlilllll-------------------------------


                         -         -         *         -         -         -         -:140
query           ISRDQAAAMEMHSAVALTPEGRPMSSREAVVLISLTKTGYTTPSNVVIRGITPLGVEMRPQVRLTRGRMF
PF02687         ----------------------------------------------------------------------
PF02687         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KPGSSEIIVGSSIAKGYDNVSIGDHLRFAQRDWTVVGHFDAGGSGFDSEIWGDVDQLMQSFRRTSYSSMA
PF02687         -----------------------------------------------------------------vnsll
PF02687         -----------------------------------------------------------------vnsll


                         -         -         -         +         -         -         -:280
query           VRLADSDAFDRFRADIDVDPRLANEAKREQQFYSDQSKALSAFINILGLTLTTIFSVAAMIGAMITMYAS
PF02687         vklkdpedlealaeelkklllssldvvstdsadslsdqllqlssiillllllsvlilllavlilllllsi
PF02687         vklkdpedlealaeelkklllssldvvstdsadslsdqllqlssiillllllsvlilllavlilllllsi


                         -         *         -         -         -         -         +:350
query           VANRVGEIGTLRALGFQRINVLAAFLIEAVLLGLVGGVAGLLCASLMQFASFSTTNFQTFADLSFRFVLT
PF02687         sirerrkeigilkalGaskkqifkqlllealligliglllGlllglllaqllsqallkfss.....sslp
PF02687         sirerrkeigilkalGaskkqifkqlllealligliglllGlllglllaqllsqallkfss.....sslp


                         -         -         -         -         *         -         -:420
query           PGIVIKTLLFSMTMGLIGGFLPALRASRLNIVDALRAR--------------------------------
PF02687         isldpisillllllilliallasllparril---------------------------------------
PF02687         isldpisillllllilliallasllparril---------------------------------------