[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF08678.1


[Show Plain Result]

## Summary of Sequence Search
   1::121
  20::65   PF01022 0.0% 47.8260869565217  Bacterial regulatory protein, arsR family 
  31::66   PF09339 0.0% 33.3333333333333  IclR helix-turn-helix domain 
  23::62   PF08279 0.0% 35  HTH domain 
  30::70   PF01978 0.0% 36.5853658536585  Sugar-specific transcriptional regulator TrmB 
  31::71   PF09012 0.0% 26.8292682926829  FeoC like transcriptional regulator 
   1::121


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLNYSDPHVALDATFQALADTTRRTMLAQLARGPLSVTELARPLAMSLPAVMQHLSVLEQAGLVRTEKVG
PF01022         -------------------dptRlkIlklLaegelcvcelaeelglsqstvShHLkkLreaGLVe-----
PF09339         ------------------------------apqelslselArrtglpkStvhRlLqtLvelGyveq----
PF08279         ----------------------llqilelLlqarepvsgeeLAeeLnVSrrtirrdIkaLee--------
PF01978         -----------------------------lkkgpatadeiaeelgvprskvyevLrsLekkGlverekgr
PF09012         ------------------------------krgrvslseLskhfkisedaleaMLevwirKGkvekveds


                         -         -         *         -         -         -         -:140
query           RVRTCTMAPKALSEAEQWINARRAEWEGHFDRLGEYLETMKKEAASDGNGN-------------------
PF01022         ----------------------------------------------------------------------
PF09339         ----------------------------------------------------------------------
PF08279         ----------------------------------------------------------------------
PF01978         ----------------------------------------------------------------------
PF09012         n---------------------------------------------------------------------