[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF08687.1


[Show Plain Result]

## Summary of Sequence Search
   1::564
 307::362  PF00483 0.0% 37.5  Nucleotidyl transferase 
  86::123  PF00463 0.0% 42.1052631578947  Isocitrate lyase family 
 307::357  PF01128 0.0% 35.4166666666667  Uncharacterized protein family UPF0007 
   1::564


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNAHDPNLLATSRSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASW
PF00483         ----------------------------------------------------------------------
PF00463         ----------------------------------------------------------------------
PF01128         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQPLAD
PF00483         ----------------------------------------------------------------------
PF00463         ---------------rPivadadtGfGGltavlkltklfierGaagihiedqa-----------------
PF01128         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           IDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHSKLSKADEIVTFAR
PF00483         ----------------------------------------------------------------------
PF00463         ----------------------------------------------------------------------
PF01128         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EWAGRAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAASSMQAVAREIHDSQTLVNVEDRIATVNE
PF00483         ----------------------------------------------------------------------
PF00463         ----------------------------------------------------------------------
PF01128         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IFRLQDADEYSAAEKIYLTGGQAPSSAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGI
PF00483         --------------------------avILaGGsGtRLwPltrtlakklvpvlgkerliqytlsrlansg
PF00463         ----------------------------------------------------------------------
PF01128         --------------------------vvipAAGsGkRm...kaglpKqflelkgqtllehtvdallaska


                         -         -         -         -         *         -         -:420
query           NDITVVGGYKAEAIDAAGIKLVRNERHAATGELASLACAADSLETDTVVSYGDLMFRSYILRDLLETDAP
PF00483         ieeiivvltqeh----------------------------------------------------------
PF00463         ----------------------------------------------------------------------
PF01128         vdkivvv---------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           FSVVVDSSESAPSNQSVRDFAWCSAADDRDLFGQKVLLRKISDTPAATDGEPHGRWIGLLNVRGEGRARL
PF00483         ----------------------------------------------------------------------
PF00463         ----------------------------------------------------------------------
PF01128         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           QKLLAELRQRPDFDSLDMPDLINALVEAGEKVEVRYVHGHWRGVNDLEDFRRAGDFAHTQTPYALGNNDG
PF00483         ----------------------------------------------------------------------
PF00463         ----------------------------------------------------------------------
PF01128         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           ETAR------------------------------------------------------------------
PF00483         ----------------------------------------------------------------------
PF00463         ----------------------------------------------------------------------
PF01128         ----------------------------------------------------------------------