[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF08754.1


[Show Plain Result]

## Summary of Sequence Search
   1::183
   5::38   PF04290 0.0% 20.5882352941176  Tripartite ATP-independent periplasmic transporters 
  30::160  PF04290 0.0% 23.8461538461538  Tripartite ATP-independent periplasmic transporters 
   1::183


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEAPILRKRWLDHLLDVCAALGALCILAVCIVMIAMSISRETSITLKGGDDIVAWLCAASAFLILGQTFQ
PF04290         ----llydrlpprvrrlldlladllalafvllilaqvvlRyvfnaplpwaeElaryllvwlvflgaayal
PF04290         ----llydrlpprvrrlldlladllalafvllilaqvvlRyvfnaplpwaeElaryllvwlvflgaayal


                         -         -         *         -         -         -         -:140
query           HGGIVRVEMLLEAVGTKRRWLLEVISLTICLIFAGYAAWALGSFAWQSWDIGDVSQGQIVIPLWIPQSFA
PF04290         rrgahirvdllydrlpprvrrlldlladllalafaavlawagwalke.aalraeesttalgiplwiiylv
PF04290         rrgahirvdllydrlpprvrrlldlladllalafaavlawagwalke.aalraeesttalgiplwiiylv


                         +         -         -         -         -         *         -:210
query           VIGALGFLLAVGDEWLRVVRRQKPRYQLAQEAKLAAGDFGETV---------------------------
PF04290         lpvgfallalaalarllrll--------------------------------------------------
PF04290         lpvgfallalaalarllrll--------------------------------------------------