[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF08803.1


[Show Plain Result]

## Summary of Sequence Search
   1::238
   6::158  PF00106 0.0% 30.2013422818792  short chain dehydrogenase 
   6::28   PF08659 0.0% 47.8260869565217  KR domain 
  45::156  PF08659 0.0% 23.1481481481481  KR domain 
   7::135  PF01370 0.0% 25  NAD dependent epimerase/dehydratase family 
   7::111  PF04321 0.0% 28.735632183908  RmlD substrate binding domain 
   1::238


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAERRTALVTGATKGIGLALSKHLQQLGWSVIGVARHAIEGFPGQLLTADLADIQQTDAVLAQVVAASRI
PF00106         -----tvliTGGlgglGlalArwLveegarhlvlvsrredapgaaeliaelealgaevtvvacDvadrda
PF08659         -----tyLvtGGlgglGlelarwLaerg----------------tvvaaDvadrdavealleeveaeepp
PF08659         -----tyLvtGGlgglGlelarwLaerg----------------tvvaaDvadrdavealleeveaeepp
PF01370         ------ilVtGgtGfiGsalveallekgyevvdnlirrtrseelaterlrvelvegdlt.dkdalerlfa
PF04321         ------ilvtGanGqlGteLaralkeegvevvaldre.............eldltdpeav.aalvkeakp


                         -         -         *         -         -         -         -:140
query           DAVINNAGIALPQKLESLDLPSLQTVFDLNVRAAVQVTQACLPSLKQSPAGRIVNVCSRAIHGARDRTSY
PF00106         laallaeirkelgpldgvvhaagvlddglleeltperlervlapkvtgawllheltld....adlgafvl
PF08659         lrGvvhaAgvlrdallaemtaedlaavlapKvtGawnLhellad....epldffvlfSSiagvlgsagqa
PF08659         lrGvvhaAgvlrdallaemtaedlaavlapKvtGawnLhellad....epldffvlfSSiagvlgsagqa
PF01370         eeqpdaVihlaaesg..vdass..edpadfiennvvgtlnlleaar...kagv.krlvflsSsev-----
PF04321         dvvvnaAAytavdkaEse....eeeayavnaegpenlAeaa-----------------------------


                         +         -         -         -         -         *         -:210
query           AAAKSALIGVTRTWALELAPLGITANAVAPGPVETELFRLTHPVGSDEEKRILATIPMQRLGKPEEVASL
PF00106         fSSvagvlgspgqaaYaa----------------------------------------------------
PF08659         nyaaanaflDalaehr------------------------------------------------------
PF08659         nyaaanaflDalaehr------------------------------------------------------
PF01370         ----------------------------------------------------------------------
PF04321         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ISYLISDGASFVTGQVIGIDGGGSLGGR------------------------------------------
PF00106         ----------------------------------------------------------------------
PF08659         ----------------------------------------------------------------------
PF08659         ----------------------------------------------------------------------
PF01370         ----------------------------------------------------------------------
PF04321         ----------------------------------------------------------------------