[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF08950.1


[Show Plain Result]

## Summary of Sequence Search
   1::114
  24::111  PF04362 0.0% 64.7727272727273  Bacterial Fe(2+) trafficking 
   1::114


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGGYSRPAGQLGYNSGQTNKESLMARMVHCIKLNKEAEGLDFPPLPGDLGKKIWQNVSKEAWAGWLKHQT
PF04362         -----------------------martvfCkklkkeaegLdfppyPgelGkriyenvskeaWkeWlkkqt


                         -         -         *         -         -         -         -:140
query           MLINENRLNMADPRARQYLIKQTEKYFFGDGADQAAGYVPPPAA--------------------------
PF04362         mliNekrLnlldpearklleeemekflfeekaekaegyvpe-----------------------------