[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF09080.1


[Show Plain Result]

## Summary of Sequence Search
   1::264
   9::177  PF00106 0.0% 29.0123456790123  short chain dehydrogenase 
  11::164  PF08659 0.0% 28  KR domain 
  10::243  PF01370 0.0% 21.4953271028037  NAD dependent epimerase/dehydratase family 
   1::264


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGNALQGRHALVTGGGRGIGAAIARRLLADGASVTLLGREQAALDATVHALQSCVIEGAALGAVSADITD
PF00106         --------tvliTGGlgglGlalArwLveegarhlvlvsrredapgaaeliaele...algaevtvvacD
PF08659         ----------LvtGGlgglGlelarwLaergarhlvllsrsaapdeeaeallaelealgaevtvvaaDva
PF01370         ---------ilVtGgtGfiGsalveallekgyevvdnlirrtrseelaterl.........rvelvegdl


                         -         -         *         -         -         -         -:140
query           ADWVSGAFAGATEARGPITLLVNNAGQAYSAPFGKTDLALWQRMLEVNLTGTFICTQAALPAMLEAGWGR
PF00106         vadrdalaallaeirkelgpldgvvhaagvlddglleeltperlervlapkvtgawllheltld....ad
PF08659         drdavealleeveaeepplrGvvhaAgvlrdallaemtaedlaavlapKvtGawnLhelladepldf...
PF01370         tdkdalerlfaee.....qpdaVihlaaesgvdass.edpadfiennvvgtlnlleaarkagvkrlvfls


                         +         -         -         -         -         *         -:210
query           IVNVASTAGLIGYGYVSAYCAAKHGVIGLTRSLALELATKGVTVNAVCPGYTETDIVRDAVANIVGKTGR
PF00106         lgafvlfSSvagvlgspgqaaYaaakaaldalaesrr---------------------------------
PF08659         .fvlfSSiagvlgsagqanyaaan----------------------------------------------
PF01370         SsevYgkdaeepikEetpl...gplspYaaaKlageklveayareyglraiilrlfnvyGpr.nfdeeet


                         -         -         -         +         -         -         -:280
query           SEEQARAELAARNPQRRLVRPDEVADAVAWLCQPSASAITGQAVPVAGGEVMAG----------------
PF00106         ----------------------------------------------------------------------
PF08659         ----------------------------------------------------------------------
PF01370         kvipalirrilegee.eltllgdGtqlRdflyv-------------------------------------