[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF09298.1


[Show Plain Result]

## Summary of Sequence Search
   1::597
 487::594  PF06421 0.0% 73.1481481481482  GTP-binding protein LepA C-terminus 
   3::181  PF00009 0.0% 43.1818181818182  Elongation factor Tu GTP binding domain 
 399::484  PF00679 0.0% 30.5882352941176  Elongation factor G C-terminus 
 205::275  PF03144 0.0% 36.6197183098592  Elongation factor Tu domain 2 
  16::132  PF01926 0.0% 25.5102040816327  GTPase of unknown function 
  52::180  PF00071 0.0% 26.7716535433071  Ras family 
   1::597


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDHIRNFSIIAHIDHGKSTLADRIIQRCGGLSDREMEAQVLDSMDIEKERGITIKAQTAALSYKARDGQV
PF06421         ----------------------------------------------------------------------
PF00009         --kirnigiighvDhGKtTltdallykagaiskrgeeaeaerlldklkeerergiTiksaaislel...e
PF00679         ----------------------------------------------------------------------
PF03144         ----------------------------------------------------------------------
PF01926         ---------------GKStLinaltgk..............akakvanypgtTrdpnegkvkl....edg
PF00071         ---------------------------------------------------sTigvdfytkeievd.gke


                         -         -         *         -         -         -         -:140
query           YNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAIELGVEVVPVLNKIDLPQADP
PF06421         ----------------------------------------------------------------------
PF00009         tkkrlinliDtPGHvdFskevirglrvlDgavlvvdaveGvepqteevlrlakklgvkiivviNKiDrvd
PF00679         ----------------------------------------------------------------------
PF03144         ----------------------------------------------------------------------
PF01926         keitliDtpGiiegadkkegelgkkflealeeadllllvvdaseplt.kndleladlelekk--------
PF00071         vkleiwDTAGqeefkslrslyyrdaegillvyditsresfenvkkwveeikrvaeenvpivLvGnKvDle


                         +         -         -         -         -         *         -:210
query           ANAIQEIEDVIGIDAQDATPCSAKTGQGVEDVIEALIAKVPPPKGDAAAPLQALIIDSWFDNYVGVVMLV
PF06421         ----------------------------------------------------------------------
PF00009         eaeleevveelkekllekylekgeeevpvipgSalkglgid-----------------------------
PF00679         ----------------------------------------------------------------------
PF03144         ----------------------------------------------------------------Gtvatg
PF01926         ----------------------------------------------------------------------
PF00071         ekravs.teegeelakelglkfletSAktnenveeafeel------------------------------


                         -         -         -         +         -         -         -:280
query           RVVNGTLRPKDKVLLMATGAQHLVEQVGVFSPKSIQRDELTAGQVGFVIAGIKELKAAKVGDTITTMTRR
PF06421         ----------------------------------------------------------------------
PF00009         ----------------------------------------------------------------------
PF00679         ----------------------------------------------------------------------
PF03144         rvysGtlkkGdtvrilgndtskkeivtrvrsletfngdldeavaganaGvivaikgledaiikGd-----
PF01926         ----------------------------------------------------------------------
PF00071         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AEAPLPGFKEVKPQVFAGLYPVESNQYEALRESLEKLRLNDASLQFEPEVSQALGFGFRCGFLGLLHMEI
PF06421         ----------------------------------------------------------------------
PF00009         ----------------------------------------------------------------------
PF00679         ----------------------------------------------------------------------
PF03144         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------
PF00071         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VQERLEREFDMDLITTAPTVVYQVQQRDGTVLTVENPAKMPDPSKIEAILEPIVTVNLYMPQDYVGSVMT
PF06421         ----------------------------------------------------------------------
PF00009         ----------------------------------------------------------------------
PF00679         ------------------------------------------------llEPimeveievpeeylgkvis
PF03144         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------
PF00071         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LCTQKRGAQINMSYHGKQVQLTYEIPMAEIVMDFFDRLKSVSRGYASMDYEFKEYRQSDVVKVDILINSD
PF06421         ------------------------------------------------------------------ingk
PF00009         ----------------------------------------------------------------------
PF00679         dltkrrGeilsmenagenrvvieaevPlaeli.gysteLrslTsGrgsfslefsgYepvpgekl------
PF03144         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------
PF00071         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           KVDALSVIVHRSNSQYRGREVAAKMREIIPRQMYDVAIQAAIGSNIIARENVKALRKNVLAKCYGGDISR
PF06421         kvdalslivhkekaeergrelveklkeliprqqfevaiqaaigskiiaretikalrkdvlakcyggdvsr
PF00009         ----------------------------------------------------------------------
PF00679         ----------------------------------------------------------------------
PF03144         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------
PF00071         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           KKKLLEKQKAGKKRMKQVGTVEIPQEAFLAILQVDDK---------------------------------
PF06421         kkkllekQkegkkrmkkvgnveipqeaflavlkl------------------------------------
PF00009         ----------------------------------------------------------------------
PF00679         ----------------------------------------------------------------------
PF03144         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------
PF00071         ----------------------------------------------------------------------