[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF09387.1


[Show Plain Result]

## Summary of Sequence Search
   1::209
  22::202  PF01810 0.0% 22.2222222222222  LysE type translocator 
   1::209


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEAWLTGLSTAQFLALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGA
PF01810         ---------------------slllppGpqnafvlkqgikrgfkhgllvalgallgdlvlillgvlGlal


                         -         -         *         -         -         -         -:140
query           LILASPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAVAASYMA
PF01810         llkaspivlallrlgGaayLlwlGvlalraamskkseklasseqrsvkksflmgllvsllNPkaildwls


                         +         -         -         -         -         *         -:210
query           GAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLALALTAIWIAVAGQPH-
PF01810         vigsfiak.qyaeegriifaaglilasliWfillaflaallsrrlssskvqriinvvvgvll--------