[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF09433.1


[Show Plain Result]

## Summary of Sequence Search
   1::278
 108::229  PF00665 0.0% 29.0598290598291  Integrase core domain 
   1::278


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKTVCDVLGVARSAVAAKQARSSEWRDGRRARQYDDTALVAEIHELVAGLPTYGYRRVWALLRRSHELSG
PF00665         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ASPVNAKRVYRVMHDHQLLLRRPGRRLDTRRHDGRVAVDRSNTRWCSDGFEFRCDDGSPLRVTFALDCHD
PF00665         -------------------------------------atrpgelwqiDvtpgripskggkaylltaiddf


                         +         -         -         -         -         *         -:210
query           REAISWAATTGGHSGDIVRDVMLAAVEQRFGAVQTEQTIEWLSDNGSAYIDHRTRSFARELGLEPLTTPV
PF00665         srfivaealkde.ssaetvadlleraverrggve....pkrllsDngseftskafeallkelgirhkftr


                         -         -         -         +         -         -         -:280
query           RSPQSNGMAESFVKTMKRDYIAFMNKPDVPTALSQLTVAFEQYNDWHPHKALKYRSPREFRRAATSST--
PF00665         pyrpqdngkvErfnrtlke---------------------------------------------------