[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF09441.1


[Show Plain Result]

## Summary of Sequence Search
   1::634
  73::257  PF00270 0.0% 44.7852760736196  DEAD/DEAH box helicase 
 329::405  PF00271 0.0% 48.0519480519481  Helicase conserved C-terminal domain 
   1::634


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTQHDFRAEQPIASATDAFATPADAASPLDKLDAMLNADAAPAVEASENGFAKLGLDAAILRALAEANYN
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TPTPVQAQAIPAFLAGRDLLVSSQTGSGKTAAFMLPAIQRISEKPATHRPTEPAKRMKGKRPRPSPAQPS
PF00270         --tpiQaeaiplileggdvlvaaeTGsGKTlaflipvlqilyetl....................pnapk
PF00271         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LLVLTPTRELALQVTEAAAKYGRHLRRIVCASILGGMPYPKQLAMLARMPDILVATPGRLLDHIEAGRID
PF00270         alivaPtreLaeqtlenlkkfkky.lklrvlliiggvsardqlsvl.ngvdivvgtpgrlddllstgkln
PF00271         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LSALEMLVFDEADRMLDMGFADDIDAIVAATPASRQTLMFSATLDARIAQLASRQLRDPQRIEIAAARAD
PF00270         lsqvrflvlDEadrllsqgfsddinrilnqlpqilqvivlSATlpkd-----------------------
PF00271         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           HSNIEQRLHFTDDMSHKERLLDHLLRDASLKQAIVFTATKRDADSLAERLSDTGFSAGALHGDMTQGARN
PF00270         ----------------------------------------------------------------------
PF00271         ------------------------------------------------llekkgikvailhgelpqnere


                         -         -         -         -         *         -         -:420
query           RTLTALRRGNLRVLVATDVAARGIDVPDITHVVNFDLPKQAEDYVHRIGRTGRAGRSGVAINLVNHGDMF
PF00270         ----------------------------------------------------------------------
PF00271         eileqFnagkskvlvatnvaerGidlpdvnlVinfdlprsvtsyiQriGRagRag---------------


                         -         -         +         -         -         -         -:490
query           QWRRIERFTNNRIDASVIEGFEPRRSPKPRSNFGGKPGGRDGFRGNGGTGGGYRGNNGSGGYRGNREGSG
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           DRNFGERRFSSDNRGFGDRAPRPFGDDNRGGFGDRGERGFGDRSNGNSNGGYRGQGQGQGQGQAQQRSFG
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           GERSFGNRDFAQRDGNRDATQRDGNRSFGGNRDGQRDGNRSFGDRSFGDRKFGDRGGDRGGFGGQRNSRS
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           RYER------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------