[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF09446.1


[Show Plain Result]

## Summary of Sequence Search
   1::166
   4::160  PF00186 0.0% 57.9617834394904  Dihydrofolate reductase 
   1::166


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTLLTLIVARARNGVIGRNNTLPWRLPEDLQHFKRTTMGAPIIMGRKTWDSIGRPLPGRRNIVVTRNRDL
PF00186         ---islivAvdkngvIGkdnklpwhlpeDlkrFkklttgkpvimGrkTfeslgkrpLpnrkniVltrnkd


                         -         -         *         -         -         -         -:140
query           HIEGADVVGSIEDAQRLCIGAEQVFLIGGAQLYAEALPSADRLIVTEIDADVEGDAFFPAVDRTTWVETA
PF00186         lkaegvevvssleealalakeeeeevfviGGaeiyeqalpladklylTeidaefegDtffpeidesewel


                         +         -         -         -         -         *         -:210
query           RELHHSETNGFDYAFVTYERPASGEE--------------------------------------------
PF00186         vsreehekdeknkykytfvt--------------------------------------------------