[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF09485.1


[Show Plain Result]

## Summary of Sequence Search
   1::149
   4::146  PF09424 0.0% 53.8461538461538  Yqey-like protein 
   1::149


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSLKARINDDMKAAMRAREAERLGTVRLLLAAIKQREVDERIELDDAGITAVIDKMIKQRKDSISQFEQA
PF09424         ---keklkedlkeamkakdkerlstlrllkaaikqeevderkelsdeevlkvlakevkqRresieefeka


                         -         -         *         -         -         -         -:140
query           GRDDLVAKEKAELDVLVAYMPAQLSDAEVAAEVQKAVTESGAAGPQDMGKVMGLVKARLAGRADMTAVSA
PF09424         gRedlaekekaEievleeYlPeqlseeeiealvkeaiaevgaesmkdmGkvmkalkpklkGkaDgkkvsa


                         +         -         -         -         -         *         -:210
query           LVKAALAPK-------------------------------------------------------------
PF09424         lvkekL----------------------------------------------------------------