[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF09628.1


[Show Plain Result]

## Summary of Sequence Search
   1::188
  42::60   PF00692 0.0% 26.3157894736842 PF00692 dUTPase 
  82::184  PF00692 0.0% 18.4466019417476 PF00692 dUTPase 
   1::188


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSIKSDKWIRRMAEQHGMIEPFEPGQVRESDGRKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
PF00692         -----------------------------------------dAgyDLsaakdftlkpget----------
PF00692         -----------------------------------------dAgyDLsaakdftlkpget----------


                         -         -         *         -         -         -         -:140
query           EKSFVDFKGDVCIIPPNSFALARTMEYFRIPRSVLTICLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
PF00692         -----------ftlkpgetvlvptdlsislpkgtaglilgrsslaakglivlpgiidsdyrGeikvvlfn
PF00692         -----------ftlkpgetvlvptdlsislpkgtaglilgrsslaakglivlpgiidsdyrGeikvvlfn


                         +         -         -         -         -         *         -:210
query           TTPLPAKIYAGEGCAQVLFFESDEICETSYADRGGKYQGQQGVTLPKT----------------------
PF00692         lgkkdvtikkgdriaQLillpvvhaelepveelertergssgfg--------------------------
PF00692         lgkkdvtikkgdriaQLillpvvhaelepveelertergssgfg--------------------------