[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF09694.1


[Show Plain Result]

## Summary of Sequence Search
   1::289
   1::163  PF03446 0.0% 40.4907975460123  NAD binding domain of 6-phosphogluconate dehydrogen 
   3::66   PF03807 0.0% 37.5  NADP oxidoreductase coenzyme F420-dependent 
   3::84   PF02737 0.0% 23.4567901234568  3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 
 125::160  PF02737 0.0% 30.5555555555556  3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 
   1::289


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTTVAFIGLGAMGAPMVGHLIRAGHTVRAFVRRPEAADAARQLGAEPFFTPAEAAQGAAVVFTNVTSSED
PF03446         kkkigfiGlGvMGsnmarnllkagykvavydrtkekveelvaegaeaaesieefvasldvvilmvpagka
PF03807         --kigiiGaGnigealakglaaagaqkheviiaasrspekaeelaeelgvkvtavsneeaaeeadv----
PF02737         --kvaVvGaGtmGagiAavfaragleVvlvdiseealekalerieksleklvekgklkeeeveevlaris
PF02737         --kvaVvGaGtmGagiAavfaragleVvlvdiseealekalerieksleklvekgklkeeeveevlaris


                         -         -         *         -         -         -         -:140
query           VREVLLGRNGVVEGAAPGTICVDHSTISPIVTREIAQALAACGIEALDCPVSGGTVGAQAATLTIMVGGK
PF03446         vdeviegekgllealekgdilidgstispedtrelakelkekglrfldapVsGGeegAekGtLsimvGGd
PF03807         ----------------------------------------------------------------------
PF02737         vttdleeav.dadl----------------------------------------tmGagiAavfaragle
PF02737         vttdleeav.dadl----------------------------------------tmGagiAavfaragle


                         +         -         -         -         -         *         -:210
query           AEVLEKVRPLLEQIGKTITHIGDSGAGQVAKLCNQIAQVVNIEGIAEAMRFAGAQGVDTAKVFQAMSTGM
PF03446         eeafervkpileaiaanvtvvGe-----------------------------------------------
PF03807         ----------------------------------------------------------------------
PF02737         Vvlvdiseealekaleriek--------------------------------------------------
PF02737         Vvlvdiseealekaleriek--------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AGSRMLDMLGPKMVTRDFSAGIESRLHAKDFGLAADIATEIGLELPAMRATSAQLGELMDQGWGKDDTSS
PF03446         ----------------------------------------------------------------------
PF03807         ----------------------------------------------------------------------
PF02737         ----------------------------------------------------------------------
PF02737         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LLKVLELKG-------------------------------------------------------------
PF03446         ----------------------------------------------------------------------
PF03807         ----------------------------------------------------------------------
PF02737         ----------------------------------------------------------------------
PF02737         ----------------------------------------------------------------------