[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF09846.1


[Show Plain Result]

## Summary of Sequence Search
   1::873
  15::427  PF00133 0.0% 30.3951367781155  tRNA synthetases class I (I, L, M and V) 
 433::588  PF00133 0.0% 26.9503546099291  tRNA synthetases class I (I, L, M and V) 
 635::676  PF00133 0.0% 40.4761904761905  tRNA synthetases class I (I, L, M and V) 
  44::177  PF09334 0.0% 30.3030303030303  tRNA synthetases class I (M) 
 429::449  PF09334 0.0% 42.8571428571429  tRNA synthetases class I (M) 
 635::676  PF09334 0.0% 38.0952380952381  tRNA synthetases class I (M) 
 714::835  PF08264 0.0% 31.3559322033898  Anticodon-binding domain 
  37::163  PF01406 0.0% 23.9669421487603  tRNA synthetases class I (C) catalytic domain 
 635::679  PF01406 0.0% 27.2727272727273  tRNA synthetases class I (C) catalytic domain 
  17::86   PF01921 0.0% 27.9411764705882  tRNA synthetases class I (K) 
 630::673  PF01921 0.0% 27.906976744186  tRNA synthetases class I (K) 
   1::873


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVRNYTINDVMAR
PF00133         --------------lekWeeedlfkkslek....ekekekFvlvdgPPnatGslHiGhalaktlkdivir
PF00133         --------------lekWeeedlfkkslek....ekekekFvlvdgPPnatGslHiGhalaktlkdivir
PF00133         --------------lekWeeedlfkkslek....ekekekFvlvdgPPnatGslHiGhalaktlkdivir
PF09334         -------------------------------------------ttalpYvngkpHlGhlystiaaDvlar
PF09334         -------------------------------------------ttalpYvngkpHlGhlystiaaDvlar
PF09334         -------------------------------------------ttalpYvngkpHlGhlystiaaDvlar
PF08264         ----------------------------------------------------------------------
PF01406         ------------------------------------kkvtlYvCGptvy..dashlGhaRslvvfDvlrr
PF01406         ------------------------------------kkvtlYvCGptvy..dashlGhaRslvvfDvlrr
PF01921         ----------------aWadeeaeklieerkkkkk.ekde.vvvesGispSGliHiGnlrevltadlvak
PF01921         ----------------aWadeeaeklieerkkkkk.ekde.vvvesGispSGliHiGnlrevltadlvak


                         -         -         *         -         -         -         -:140
query           YLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYR
PF00133         ykrmkGkdveyvpGwDhhGlpieakvekklgkkekkereklgrekfrekvrewkaeyaeeirkqvkrLGv
PF00133         ykrmkGkdveyvpGwDhhGlpieakvekklgkkekkereklgrekfrekvrewkaeyaeeirkqvkrLGv
PF00133         ykrmkGkdveyvpGwDhhGlpieakvekklgkkekkereklgrekfrekvrewkaeyaeeirkqvkrLGv
PF09334         ykrlrgeevlfvtgtDehGtkielkAekegltpqelvdkvseefkelfkklnisfD..kfirTtseehke
PF09334         ykrlrgeevlfvtgtDehGtkielkAekegltpqelvdkvseefkelfkklnisfD..kfirTtseehke
PF09334         ykrlrgeevlfvtgtDehGtkielkAekegltpqelvdkvseefkelfkklnisfD..kfirTtseehke
PF08264         ----------------------------------------------------------------------
PF01406         ilqalgYdvqfvqnvtDidDkiikrarqeeksvkelaekfieeykkdleaLnvlkptletrvtekideii
PF01406         ilqalgYdvqfvqnvtDidDkiikrarqeeksvkelaekfieeykkdleaLnvlkptletrvtekideii
PF01921         alrkrgeevrlilisD------------------------------------------------------
PF01921         alrkrgeevrlilisD------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           WNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLANEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQELLG
PF00133         svdwdreylTldeeleeavievfvelakkGliyrgkklvnwstklktalselEv.eykdvk.........
PF00133         svdwdreylTldeeleeavievfvelakkGliyrgkklvnwstklktalselEv.eykdvk.........
PF00133         svdwdreylTldeeleeavievfvelakkGliyrgkklvnwstklktalselEv.eykdvk.........
PF09334         lvqeffkklkekgliyekeieqlYcvsderflpdryv---------------------------------
PF09334         lvqeffkklkekgliyekeieqlYcvsderflpdryv---------------------------------
PF09334         lvqeffkklkekgliyekeieqlYcvsderflpdryv---------------------------------
PF08264         ----------------------------------------------------------------------
PF01406         e....lvekliekgyaYvssdgd-----------------------------------------------
PF01406         e....lvekliekgyaYvssdgd-----------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DLEGLGWPERVKIMQQNWIGRSEGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPL
PF00133         ......................................dalihvafpl....adkke.....aklviwTT
PF00133         ......................................dalihvafpl....adkke.....aklviwTT
PF00133         ......................................dalihvafpl....adkke.....aklviwTT
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ATHAAESNPALAAFIEECKHGSVMEADMATMEKKGMPTGLKVTHPLTGEQVDVWVGNYVLMTYGDGAVMG
PF00133         tPwTllgntavavnpeleyv...vedellilaeallesllkkkkee..ledergkeL.egkkvelplldr
PF00133         tPwTllgntavavnpeleyv...vedellilaeallesllkkkkee..ledergkeL.egkkvelplldr
PF00133         tPwTllgntavavnpeleyv...vedellilaeallesllkkkkee..ledergkeL.egkkvelplldr
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VPAHDERDFAFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGLCIHSGKYDGLGYKAAVDAIAADLA
PF00133         eipiiadeyvdkeaGtGiVkiaPahgedDyevgkkhnlevinvldedGtlneea................
PF00133         eipiiadeyvdkeaGtGiVkiaPahgedDyevgkkhnlevinvldedGtlneea................
PF00133         eipiiadeyvdkeaGtGiVkiaPahgedDyevgkkhnlevinvldedGtlneea................
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           AKGLGEKKVTWRLRDWGISRQRYWGTPIPLIHCDSCGVVPVPEKDLPVVLPEDLVPDGTGNPLAKDPRFL
PF00133         .eefegl-----iqdWcisRqrwWGtripvwvsketeevvvre.elkelvakrleeeaeekalekeakdk
PF00133         .eefegl-----iqdWcisRqrwWGtripvwvsketeevvvre.elkelvakrleeeaeekalekeakdk
PF00133         .eefegl-----iqdWcisRqrwWGtripvwvsketeevvvre.elkelvakrleeeaeekalekeakdk
PF09334         --------lkegLkdlsisrdlkwGipvp-----------------------------------------
PF09334         --------lkegLkdlsisrdlkwGipvp-----------------------------------------
PF09334         --------lkegLkdlsisrdlkwGipvp-----------------------------------------
PF08264         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           ECTCPSCGKPARRETDTMDTFIDSCWYYMRYTCPDAGTMVDARNDYWMPMDQYIGGIEHAILHLLYARFW
PF00133         l....kkekgklekdedvlDvWFdSgstpfsvlgypee...ntkefkkffpadllleGlDq.......ir
PF00133         l....kkekgklekdedvlDvWFdSgstpfsvlgypee...ntkefkkffpadllleGlDq.......ir
PF00133         l....kkekgklekdedvlDvWFdSgstpfsvlgypee...ntkefkkffpadllleGlDq.......ir
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           TKVMRDMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKTWYNPADVDVQTDERGRPAGATAKADGQPVV
PF00133         gWvarlillslaltgkepykevlvhglv------------------------------------------
PF00133         gWvarlillslaltgkepykevlvhglv------------------------------------------
PF00133         gWvarlillslaltgkepykevlvhglv------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01921         ---------------------------------------------------------------------l
PF01921         ---------------------------------------------------------------------l


                         -         +         -         -         -         -         *:700
query           IGGIEKMSKSKNNGIDPQALIDQYGADTARLFVMFAAPPEQQLEWSGSGVEGASRFLRRVWNYGYANAQA
PF00133         ----rKMSKslgNvidpldvikkygadalRltliassdvgrdinls------------------------
PF00133         ----rKMSKslgNvidpldvikkygadalRltliassdvgrdinls------------------------
PF00133         ----rKMSKslgNvidpldvikkygadalRltliassdvgrdinls------------------------
PF09334         ----ekmSkSrgnvvdpeelleelgvdalRYyllreapekkDsdfs------------------------
PF09334         ----ekmSkSrgnvvdpeelleelgvdalRYyllreapekkDsdfs------------------------
PF09334         ----ekmSkSrgnvvdpeelleelgvdalRYyllreapekkDsdfs------------------------
PF08264         ----------------------------------------------------------------------
PF01406         ----ekmsksLknfltikdvlkkfdprqlRlllls.ahyrsqldfkeel---------------------
PF01406         ----ekmsksLknfltikdvlkkfdprqlRlllls.ahyrsqldfkeel---------------------
PF01921         lkggekmssSkGnvitvedwlevaepevlr.fliarkkPkkak---------------------------
PF01921         lkggekmssSkGnvitvedwlevaepevlr.fliarkkPkkak---------------------------


                         -         -         -         -         +         -         -:770
query           IRDGAGTAPTADDAALRREIHTVLKQANYDYERIQYNTVVSATMKMLNALEDAKTASPAGRREGFSVLLR
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF08264         -------------rwilselnelikevteayeeyrfnkavsalyeffwndlcdwylelvkprlysesaed
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           VLYPVVPHIAHGLWQELGYAAETVDILDAAWPQVDEAALVRSEIELVLQVNGKVRGSLTVPADADRAAIE
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF08264         srraqyvllevletllrllaPimPfltEelwqrl...eeeklgkeesimlaewpe.dseelekea-----
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           ATAAASEIVAKFAAGAAPKKIVVVPGRLVNVVL-------------------------------------
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------