[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rmet0:ABF09882.1


[Show Plain Result]

## Summary of Sequence Search
   1::302
   1::302  PF05621 0.0% 94.0397350993377  Bacterial TniB protein 
   1::302


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEEYPIIDLSHLLPAAQGLARLPADERIHRLRADRWIGYPRAVEALNRLEILYTWPNKQRMPNLLLVGPT
PF05621         mdeypvidlshllpaaqglarlpaderiqrlradrwigypravealnrlealyawpnkqrmpnlllvgpt


                         -         -         *         -         -         -         -:140
query           NNGKSMIVEKFRRTHPARADADQEHIPVLVVQMPSEPSVIRFYVALLAAMGAPLRPRPRLPEMEQLALAL
PF05621         nngksmivekfrrahpvssdadqehipvlvvqmpsepsvirfyvallaamgaplrprprltemeqlalal


                         +         -         -         -         -         *         -:210
query           LRKVGVRMLVIDELHNVLAGNSVNRREFLNLLRFLGNELRIPLVGVGTRDAYLAIRSDDQLENRFEPMML
PF05621         lrkvgvrmlvidelhnvlagnsvnrreflnllrflgnelriplvgvgtreaylairsddqlenrfepmll


                         -         -         -         +         -         -         -:280
query           PVWEANHDCCSLLASFAASLPLRRPSSIATLDMARYLLTRSEGTIGELAHLLMAAAIVAVESGEEAINHR
PF05621         pvweanedccsllasfaaslplrrpspiatldmarylltrsegtigelahllvaaavvavesgeeainhr


                         -         *         -         -         -         -         +:350
query           TLSMADYTGPSERRRQFERELM------------------------------------------------
PF05621         tlsmavyigpserrrqferelm------------------------------------------------