[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF07116.1


[Show Plain Result]

## Summary of Sequence Search
   1::444
 147::377  4.2e-70 42.9% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
 102::405    2e-54 33.7% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
 133::377    9e-49 31.2% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
 153::382  9.8e-49 49.0% 0039713 00397131 1/1   p containing nucleoside triphosphate hy 
 133::393  3.5e-48 34.8% 0047665 00476651 1/1   p containing nucleoside triphosphate hy 
 125::378    6e-45 27.8% 0040238 00402381 1/1   p containing nucleoside triphosphate hy 
 159::411  1.2e-44 35.0% 0046258 00462581 1/1   p containing nucleoside triphosphate hy 
 147::379  2.1e-44 35.1% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
   5::193  5.3e-44 42.8% 0043525 00435251 1/1   like                                    
 135::379  1.1e-43 34.7% 0049491 00494911 1/1   p containing nucleoside triphosphate hy 
 147::379  2.7e-43 31.6% 0049053 00490531 1/1   p containing nucleoside triphosphate hy 
 140::377  5.8e-41 32.9% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
 147::410  5.8e-41 24.0% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
 138::394  1.1e-40 31.5% 0047420 00474201 1/1   p containing nucleoside triphosphate hy 
 143::379  1.2e-34 28.9% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
 132::379  1.3e-34 28.1% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
   7::190  1.5e-33 32.4% 0048997 00489971 1/1   like                                    
   2::136  4.8e-32 35.6% 0039925 00399251 1/1   like                                    
 133::377  1.5e-31 26.5% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
   7::127  5.9e-31 38.3% 0051573 00515731 1/1   like                                    
   8::140  6.9e-31 36.8% 0048975 00489751 1/1   like                                    
   7::143  7.2e-31 36.5% 0050341 00503411 1/1   like                                    
 148::340  2.5e-30 32.9% 0049757 00497571 1/1   p containing nucleoside triphosphate hy 
   8::144  3.7e-30 35.0% 0048465 00484651 1/1   like                                    
   6::133  6.5e-30 38.3% 0051318 00513181 1/1   like                                    
 135::377  7.1e-30 31.0% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
   4::139    8e-30 36.6% 0050342 00503421 1/1   like                                    
   4::128    9e-30 36.8% 0047555 00475551 1/1   like                                    
   5::127  1.3e-29 38.2% 0046294 00462941 1/1   like                                    
   2::127    5e-29 36.5% 0048705 00487051 1/1   like                                    
   5::127  5.8e-29 38.2% 0047867 00478671 1/1   like                                    
   5::132  7.1e-29 38.3% 0051860 00518601 1/1   like                                    
   8::127  7.1e-29 36.1% 0051574 00515741 1/1   like                                    
   7::128  7.8e-29 38.5% 0047799 00477991 1/1   like                                    
   5::141    1e-28 35.3% 0045700 00457001 1/1   like                                    
   6::126  1.1e-28 38.8% 0048231 00482311 1/1   like                                    
   6::128  1.5e-28 39.2% 0048685 00486851 1/1   like                                    
   7::126  1.5e-28 39.2% 0045852 00458521 1/1   like                                    
   6::127    2e-28 38.0% 0050964 00509641 1/1   like                                    
   6::134  2.8e-28 36.4% 0047753 00477531 1/1   like                                    
 135::377  3.6e-28 30.0% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
   7::127  4.1e-28 37.2% 0051386 00513861 1/1   like                                    
   7::123  9.1e-28 36.8% 0049761 00497611 1/1   like                                    
   7::125  1.5e-27 37.8% 0049456 00494561 1/1   like                                    
   7::123  1.7e-27 37.6% 0048656 00486561 1/1   like                                    
   7::126  2.6e-27 36.7% 0046428 00464281 1/1   like                                    
   5::137  3.2e-27 36.8% 0047296 00472961 1/1   like                                    
   6::134  3.6e-27 35.7% 0045682 00456821 1/1   like                                    
   6::130  9.4e-27 34.7% 0046299 00462991 1/1   like                                    
   4::136  1.9e-26 35.4% 0048066 00480661 1/1   like                                    
   7::127  2.4e-26 38.0% 0048129 00481291 1/1   like                                    
   8::127  4.4e-26 37.8% 0048463 00484631 1/1   like                                    
   6::125  2.9e-25 38.8% 0051898 00518981 1/1   like                                    
 140::377  9.9e-25 27.8% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
 137::376  1.9e-23 27.5% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
 138::377  4.1e-22 30.3% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
 138::377  8.9e-22 26.0% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
 119::326  7.9e-21 25.7% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
 139::378  1.7e-19 25.7% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
 132::377  3.4e-15 21.6% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
 359::445  1.2e-12 29.9% 0048440 00484401 1/1   domain-like                             
 361::445  2.2e-12 35.3% 0037176 00371761 1/1   domain-like                             
 133::406    2e-11 21.4% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
 133::377  3.7e-11 21.8% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
 128::378  1.6e-10 21.2% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
 385::446  5.1e-10 37.7% 0046907 00469071 1/1   domain-like                             
 386::445    1e-09 35.0% 0049952 00499521 1/1   domain-like                             
 112::333  1.5e-09 26.1% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
 170::332  1.5e-09 23.3% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
 142::412  1.8e-09 23.9% 0046826 00468261 1/1   p containing nucleoside triphosphate hy 
 135::326    6e-09 23.4% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
 148::339  8.6e-05 23.4% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
   1::444


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIAMQDGLRVLFVEDEPLVRQATAQSLELAGFSVLALPSAEAAMPHLGADFPGVLVTDVRLSGASGLDLL
00416171   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00397131   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00402381   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00435251   1/1  ----msglrvLvVDDdplirellrrlLerlgyevvgtaadgeeAlelleelppdlvllDirmPgmdGlel
00494911   1/1  ----------------------------------------------------------------------
00490531   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00489971   1/1  ------ltllllknlrglrilvvdddplvrellrrlLerlgyevvaaadgeeale....lrpdlvlldlr
00399251   1/1  -plslsglrvLvVdDdplirellrrlLeklgylevvltaadgeealellrelgalaglelglrpdlvllD
00379261   1/1  ----------------------------------------------------------------------
00515731   1/1  ------glriliVdDdpllrellallLeklgyvvltaadgeealellrelrpdlvllDimmPgmdGlell
00489751   1/1  -------lriliVdDdplirellrllLerlgyevltaadgeealellrelrpdlvllDirmPgmdGlell
00503411   1/1  ------glriLvVdDdpllrellrllLeklgyevltaadgeealellrelrpdlvllDimmPgmdGlell
00497571   1/1  ----------------------------------------------------------------------
00484651   1/1  -------lriLiVdDdplirellrllLeklgyevltaadgeealelleelrpdlvllDlmmPgmdGlell
00513181   1/1  -----sglrilvVdDdplirellrllLeslgyevltaadgeealellrelrpdlvllDirmPgmdGlell
00521551   1/1  ----------------------------------------------------------------------
00503421   1/1  ---llllllsllllsglriLvVdDdplirellarlLeklgyev..aadgeealellrelppdlvllDlmm
00475551   1/1  ---llsglriLvVdDdpllrellrllLeklgyevvleaadgeealellrelrpdlvllDlmmPgmdGlel
00462941   1/1  ----lsklriliVdDdplvrellallLeslgyvvltaadgeealellrelrpdlvllDlrmPgmdGlell
00487051   1/1  -llllsglriLvVdDdplirellallLeslgyevvltaadgeealellrelppdlvllDlmmPgmdGlel
00478671   1/1  ----lsglrilvvdDdpllrellallLeslgyvvltaadgeealellrelrpdlvllDlrmPgmdGlell
00518601   1/1  ----ealsslsglrilvVdDdplvrellrrlLerlgyevvtaadgeealellrelppdlvllDlrmpgmd
00515741   1/1  -------lriLvvdDdpllrellrllLeslgyvvleaadgeealellrelrpdlvllDlmmPgmdGlell
00477991   1/1  ------glrilvvdDdpllrellallLeklgyvvltaadgeealellrelppdlvllDimmPgmdGlell
00457001   1/1  ----lsklriliVdDdplirellrrlLeslgdlyvvltaadgeealellrelrpdlvllDlmmPgmdGle
00482311   1/1  -----sglrilvvdDdpllrellallLeklgyvvltaadgeealellrelrpdlvllDimmPgmdGlell
00486851   1/1  -----sglrilivdDdpllrellallLeslgyvvltaadgeealelle...pdlvllDilmPgmdGlell
00458521   1/1  ------glriLvVdDdpllrellallLeslgyvvltaadgeealellrelrpdlvllDlmmPgmdGlell
00509641   1/1  -----sglrilvVdDdpllrellrllLeslgyevltaadgeealelleelrpdlvllDimmPgmdGlell
00477531   1/1  -----kglriLiVdDdplirellrrlLeklgllyvvltaadgeealellrellalgslerpdlvllDlnm
00406781   1/1  ----------------------------------------------------------------------
00513861   1/1  ------glrilvvdDdpllrellallLeslgyvvltaadgeealellrelrpdlvllDlmmPgmdGlell
00497611   1/1  ------glrilivdDdpllrellallLeklgyevvgeaadgeealellrelrpdlvllDllmPgmdGlel
00494561   1/1  ------klrilivdDdpllrellallLeslgyvvltaadgeealellrelrpdlvllDllmPgmdGlell
00486561   1/1  ------glrilvvdDdpllrellkllLeklgyevvlvaadgeealellrellesglrpdlvllDilmPgm
00464281   1/1  ------klrilivdDdpllrellrllLeslgllyvvltaadgeealelleelrpdlvllDimmPgmdGle
00472961   1/1  ----lsglriLiVdDdplirellrrlLeklgllyevleaadgeealellrellelgdllrpdlvllDlnm
00456821   1/1  -----kklriliVdDdplirellrrlLeslgdlyvvleaadgeealellrelrpdlvllDlmmPgmdGle
00462991   1/1  -----lllelsglrvLvVdDnplnrellkalLeklgyevltasngeealell.elppdlvllDiqmPgmd
00480661   1/1  ---lrsklrilivdddpalrellrrlLeaegyqvlvaesgeealelleehrpdlvlldlmlPgmdglell
00481291   1/1  ------glriLvvdDdpllrellallLeklgyvvltaadgeealellrelrpdlvllDimmPgmdGlell
00484631   1/1  -------lrilivdDdpllrellallLeklgyvvltaadgeealellrelrpdlvllDimmPgmdGlell
00518981   1/1  -----sglrilvvdDdpllrellallLeslgyevvtaadgeealellrelerpdllvllD.llPgmdGle
00420941   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00484401   1/1  ----------------------------------------------------------------------
00371761   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00469071   1/1  ----------------------------------------------------------------------
00499521   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00468261   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QHCRNAAPGVPVILVTGHGDITMAVQAMREGAYDFIEKPFGADRLTETVRRALERRALELENHALRRELA
00416171   1/1  ----------------------------------------------------------------------
00444381   1/1  -------------------------------asdelekllelrpvlledvigqeeakkalslalelplkr
00418301   1/1  --------------------------------------------------------------drpllekl
00397131   1/1  ----------------------------------------------------------------------
00476651   1/1  --------------------------------------------------------------yeplvekl
00402381   1/1  ------------------------------------------------------Plsklleddlplllkl
00462581   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00435251   1/1  lrrlre.lpdipvillTayadeedavraleaGaddyltKPfdleeLlaalrralerrrllrelrlllell
00494911   1/1  ----------------------------------------------------------------llvekl
00490531   1/1  ----------------------------------------------------------------------
00379961   1/1  ---------------------------------------------------------------------y
00430121   1/1  ----------------------------------------------------------------------
00474201   1/1  -------------------------------------------------------------------dee
00367291   1/1  ----------------------------------------------------------------------
00368501   1/1  -------------------------------------------------------------kerllllel
00489971   1/1  mpdmdglellallre.lpdlpvivltayedpelleaaleagaldylvkPldpeeLlaalelalarfrrlr
00399251   1/1  inmPgmdGlellrrlralpllpdipvivlTaladeedrvraleaGaddyllKPfdleeLlaairal----
00379261   1/1  --------------------------------------------------------------drllleel
00515731   1/1  rrlre.lpdipvillTaladeedavraleagaddyllKPfdleeLlaalrallrrlr-------------
00489751   1/1  rrlrelgpdlpvillTayddeedavraleagaddyllKPfdleeLlaairallrrlrllrelllllllle
00503411   1/1  rrlrelpllpdipvillTalddeedavraleagaddyltKPfdleeLlarirallrrlrllselllllee
00497571   1/1  ----------------------------------------------------------------------
00484651   1/1  rrlrelgpdipvillTayadeedavealeagaddyllKPfdleeLlaairallrrlrllrelllllelle
00513181   1/1  rrlrellpdipvillTayddeedavraleagaddyllKPfdleeLlaairallrrlrllsenl-------
00521551   1/1  ----------------------------------------------------------------plvekl
00503421   1/1  PgmdGlellrrlrelpalpdipvillTalddeedrvraleaGaddyltKPfdpeeLlarirallrrrrl-
00475551   1/1  lrrlrelpllpdipvillTaladeedavraleagaddyllKPfdleeLlaalrallrr------------
00462941   1/1  rrlrellpdipvillTayddeedavealeagaddyllKPfdleeLlaairallrrlr-------------
00487051   1/1  lrrlrelpllpdipvillTaladeedavraleagaddyllKPfdleeLlaalrallr-------------
00478671   1/1  rrlrellpdlpvillTaladeedavraleagaddyllKPfdleeLlaairallrrlr-------------
00518601   1/1  GlellrrlrellpdipvillTayadeedavraleagaddyllKPfdleeLlaalrallrrlr--------
00515741   1/1  rrlre.lpdipvivlTalddeedavraleagaddyllKPfdleeLlaalrallrrlr-------------
00477991   1/1  rrlrelgpdipvillTaladeedavraleagaddyllKPfdleeLlaalrallrrlrl------------
00457001   1/1  llrrlre.lpdipvivlTalddelledavraleagaddyllKPfdleeLlaairallrrlrllsellall
00482311   1/1  rrlrelgpdipvillTalddeedavraleagaddyllKPfdleeLlaalrallrrr--------------
00486851   1/1  rrlrellpdipvillTalddeedavealeagaddyllKPfdleeLlaairallrrlrl------------
00458521   1/1  rrlrellllpdipvillTaladeedavraleagaddyllKPfdleeLlaairallr--------------
00509641   1/1  rrlre.lpdipvillTaladeedavraleagaddyllKPfdleeLlaalrallrrrr-------------
00477531   1/1  PgmdGlellrrlrelpllpdipvivlTalddeedavraleagaddyllKPfdleeLlaairall------
00406781   1/1  ----------------------------------------------------------------plvekl
00513861   1/1  rrlrelgpdipvivlTaladeedavraleagaddyllKPfdleeLlaalrallrrlr-------------
00497611   1/1  lrrlrellpdlpvivlTaladeedavealeagaddyllKPfdleeLlaalral-----------------
00494561   1/1  rrlrellpdipvillTayadledavraleagaddyllKPfdleeLlaalrallrr---------------
00486561   1/1  dGlellrrlrelllpdipvillTaladeedavraleagaddyllKPfdleeLl-----------------
00464281   1/1  llrrlrelplpdipvivlTaladeedavraleagaddyllKPfdleeLlaalrall--------------
00472961   1/1  PgmdGlellrrlrelpalpdipvivlTalddeedavraleagaddyltKPfdleeLlaairallrrl---
00456821   1/1  llrrlrellpdipvivlTayddeedavraleagaddyllKpfdleeLlaairallrrlrllsel------
00462991   1/1  GlellrrirelellpllpdipiialtayadeedreraleagaddyltKPvsleeLlaalr----------
00480661   1/1  rqLreeglllPvilltardd...rvaaldagaddyltkPfllpvdqleeLlaridaalrrflllap----
00481291   1/1  rrlrelpalpdipvillTaladeedavraleagaddyllKPfdleeLlaalrallrr-------------
00484631   1/1  rrlre.lpdipvillTalddeedavraleagaddyllKPfdleeLlaalrallrrlr-------------
00518981   1/1  llrrlrellpdlpvillTaldde..avraleag.ddyllKPfdleeLlaalrrrl---------------
00420941   1/1  ---------------------------------------------------------------------l
00404191   1/1  ------------------------------------------------------------------vell
00473941   1/1  -------------------------------------------------------------------ekl
00392701   1/1  -------------------------------------------------------------------ekl
00394721   1/1  ------------------------------------------------lvslleslelplleklrpvlld
00386741   1/1  --------------------------------------------------------------------kl
00437921   1/1  -------------------------------------------------------------lglllvekl
00484401   1/1  ----------------------------------------------------------------------
00371761   1/1  ----------------------------------------------------------------------
00437901   1/1  --------------------------------------------------------------slllveky
00437941   1/1  --------------------------------------------------------------lrplvekl
00503741   1/1  ---------------------------------------------------------fifldlrplallp
00469071   1/1  ----------------------------------------------------------------------
00499521   1/1  ----------------------------------------------------------------------
00482661   1/1  -----------------------------------------kkvaivllsnyalsislddlllildlyke
00512891   1/1  ----------------------------------------------------------------------
00468261   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------npfilg
00470731   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GPAAGTRIIGRSPAIAQVRDLIANVAATDVPVMINGETGTGKELVARSLHALSTRRDQPFIALNCGAVPE
00416171   1/1  ------diigqeeakkallealslaartgenvllvGppGtGKttlaralakllprsgvpfvrvncsalte
00444381   1/1  lelfgk.............lddligrspairrllell..garpgenvlLvGppGtGKTtlakalakll..
00418301   1/1  rpvllddviGqeeakkallealalplkrlelfeklrgirpgknvlLvGppGtGKTtlaralakll...gr
00397131   1/1  ------------pmmlyvlqliellakslapvylllGeegtgkeelaraih..............caaip
00476651   1/1  rpvllddlvgqeeakeallealag.grpprpvllvGppGtGKTtlaralanelgrpfvpvallcfvrvnc
00402381   1/1  rpdlfddvvgqdeaieallealrrarkglnlglkprgnvlLvGppGtGKTtlaralakal...gvpfvri
00462581   1/1  ------------------edleslllnplvkfedivpkvlddleealealaea.klpppkgvllyGppGt
00402371   1/1  ------dviGqeealeallealrr..rpgrnvllvGppGvGKTtlaralagllvrssgpilldgvpfvrl
00435251   1/1  elllelrlllldallllliglslallellallrk........lilgesgtgke-----------------
00494911   1/1  rpvllddlvgqeeakealleala..agrpghvllvGppGtGKTtlaralanellrlgvlglpfvrvnase
00490531   1/1  ------tlpaleseardltekarpvllddviGqeeaierllealerg..ppgnvLlvGppGtGKTtlara
00379961   1/1  rpvdfddivGqeealralslal..aagppegvllvGppGtGKstlaralagllppdsgrivlvgnlsdll
00430121   1/1  ------dvvgqeeakeallealrrgrkglelgirpggnvllvGPpGvGKTtlakalagllfpsgvpfiri
00474201   1/1  lelleklslllveklrpvllddlvgqeeakeallealr..agrpghvllvGppGtGKTtlaralanelpr
00367291   1/1  --vtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanel...gap
00368501   1/1  rnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGppGvGKTtlaralakll...ga
00489971   1/1  rlreelakleekleerklierakgllmkrrglseeeAyrllrklA.....--------------------
00399251   1/1  ----------------------------------------------------------------------
00379261   1/1  rpvllddviGqeeakealsealrlplkrlelferlglrrpgknvlLvGppGvGKTtlaralAkll...ga
00515731   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00503411   1/1  lel-------------------------------------------------------------------
00497571   1/1  -------aselvqwlldlgildeseilledlenalalllsligaklvkdllllvlkylpsllslldvlrp
00484651   1/1  lllg------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00521551   1/1  rpvllddvigqeeakeallealarlkapelflslglrpgkgvlLvGppGtGKTtlaralagll...gapf
00503421   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00457001   1/1  l---------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00406781   1/1  rpvllddvigqeeakeallealaglrlllkdlslgippgknvllvGppGtGKTtlakalagel...gvpf
00513861   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00420941   1/1  rpvllddvigqeeakeallealalplkrldlglslgirpgkgvllyGppGtGKTtlakalagel...gap
00404191   1/1  pkvtlddlvgleelkealkealellslgikpgeivllyGppGtGKTtlakalanelkkrggrvlyvsade
00473941   1/1  rpvllddvvgqeevkkalllalalallrgepgehvlLvGppGtGKTtlaralagll...gapfielsasd
00392701   1/1  rpvllddvvgqeeakeallealagarlaledlslgirpgknvlLvGppGvGKTtlaralagll...gapf
00394721   1/1  ......dvvgreealeallealrr....gpprnvlLvGppGvGKTtlakalakelaagsgpilldgvpvv
00386741   1/1  rpvllddvvgqeeakeallealkavllgirpgehllLvGppGtGKTtlaralagel...gapfvrldase
00437921   1/1  rpkllddvvgqeealerlllalk....agklphlllvGppGvGKTtlaralarlllgsgggvdvieldas
00484401   1/1  ----------------------------------------------------------------------
00371761   1/1  ----------------------------------------------------------------------
00437901   1/1  rpvllddvvgqeeakeallealalararplkrpelflslgirpgrillLyGppGvGKTtlakalakel..
00437941   1/1  rpknlddvygqeevlkalslale....kgrpehlllvGppGtGKTtlakalaglllptsggvrvlgidas
00503741   1/1  lp...drlvgrdeeiealskalggaldgvslsiepggivllvGppGvGKTtLakllagllkpkfgeillf
00469071   1/1  ----------------------------------------------------------------------
00499521   1/1  ----------------------------------------------------------------------
00482661   1/1  vqvaydnfykvdesdiayqyallakedenaaaflksnrqkklvrdladrviaeerlellekiieellrir
00512891   1/1  -----------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdvrsa
00468261   1/1  -sahvelterlrpvllstivgredqieellellfgglhrgdrliglvliyGpagsGKttilrllakllse
00527261   1/1  pkvdledfigreeelkeleeal.....pk.ivlltGprGsGKTtllkalakel...gkpviyidlselss
00470731   1/1  -------arpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGKTTlaralakel...gagf


                         -         -         -         +         -         -         -:280
query           SIFESEMFGHEAGAFTGAGKRRVGKLEHASGGTLFLDEIESMPLALQVKLLRVLQEGTLERLGSNTSIPI
00416171   1/1  dlleselfghekgafgggekqrlgllrladggvlflDEidkldpdvqnaLlrvleegeltrlgggivlpa
00444381   1/1  .gvpfiridgselte....kelvGesegailsggfkqrvgialladpgilflDEidkllddrgeaegggd
00418301   1/1  pfirvdaselte....aelvGyesgarlrelfaragigllaladpgvlflDEidkllpargssggdvsre
00397131   1/1  eglleselfgvekgadtgallekagllslfadggtlfldeigelpglelqkaLlrlleel..........
00476651   1/1  aallelsasdlleselfgeekeaflgallerlgklalagggtvlflDEidkldpdvqnaLlrllee....
00402381   1/1  nlselteallvsdliGhldg.yvgededgiltgalrkapggvlflDEidkldpdvlnaLlqvleegeltd
00462581   1/1  GKTtlaralakel...glpfvrinasdllvgllvgelegrlrglfteav........lanpgvlflDEid
00402371   1/1  daselle.......fgkyvgafegglrqllglaraakpgvlflDEidsllgarggsgvdpevqnaLlrll
00435251   1/1  ----------------------------------------------------------------------
00494911   1/1  llealllsdlfgellgallralfellrgalelakggvlflDEidrlspdvqnaLlrllee..........
00490531   1/1  lakelargdvpevlvgvpvieina.ssllfGskyvgefeealrrlfgeaekanggviLflDEidklagar
00379961   1/1  dpkdlrellragiplvflnfaalpasllesellsggerqrvalaralalrpGllvlAdggvlllDEpdal
00430121   1/1  nlseltekllvselighppg.yvGedelgvlfeaarkappsvlllDEidkldpdvlnaLlqlleegevtd
00474201   1/1  slpglpfvrvnasdltdvglle.ellgkllgaat.........fllakpgvlflDEidkldpdvqnaLlr
00367291   1/1  firvdaselle.klvgegegrlrgalaea........lradpgvlflDEidalagkrgsgtsrldpevqn
00368501   1/1  pfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpgtvlenlalgllvseligappgyvggd
00489971   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00379261   1/1  pfvevdaselteggyvgedlekrirelfqearllvfltvlenirldaseylekrvvsrligappgyvgyg
00515731   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00497571   1/1  kvdfddii.leeakeelllellelplklpelfkrlglkapkrrgvlLyGppGtGKTllakalakelgrl.
00484651   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00521551   1/1  vrlsa.........selvgkyvgelegglrqllalaraanpgvlflDEidklapkrsptsglddvsrrrv
00503421   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00406781   1/1  vrisa.........sellgkyvgelsgglrqrlalaraadpgvlllDEidalldarsgsgsggdsssrrv
00513861   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00420941   1/1  firidg.........sellgkyvgelsgglrqllalaraakpsilllDEidklapkrsptsaldadvrre
00404191   1/1  lvsklsgglqeqrvaiafalark..........pdllllDEidalgldpelqeellelldel........
00473941   1/1  llg...esdlrggfkqa..............akpgvlflDEidrldrevqnaLlelleelqvtilggglv
00392701   1/1  grvda.........sdllgkyvgelsgglrqrlarallakpsvlllDEidklapkrsptsgldvelrrrv
00394721   1/1  rldlsellsvsdlvg.elegglrglltealala.......kpsvlflDEidrlldardsesslevlnaLl
00386741   1/1  lsg.......geklrgllarala.........kpgvlllDEidaldpdvqeallelleegeltivgggll
00437921   1/1  dlrgvddlreli........gevlqalglllggkpdvlllDEidrldpdaqnallklleel.........
00484401   1/1  ----------------------------------------------------------------------
00371761   1/1  ----------------------------------------------------------------------
00437901   1/1  .gapvieidaselrdvddlsg....yvgelsggeklrellaealteavlkgkpsvlllDEidaldpdvln
00437941   1/1  elld...pselsggerqrvliarall......adpkvlllDEidaldpeaqnaLlklleel.........
00503741   1/1  gkvvyvnvselldlkellrlllealglpppyqlsggerlrvalaeallalgkpdllilDEitnlldpetl
00469071   1/1  ----------------------------------------------------------------------
00499521   1/1  ----------------------------------------------------------------------
00482661   1/1  ldklledldeiveelppvlfddlvgqeeakeallenlklflkgpellldlglpkgrgllLyGPpGtGKTt
00512891   1/1  rrgigyvfqtveellgllaelvglevrgeleellktlikelsggekqrvalarallakpdvlllDEidgl
00468261   1/1  nngvpvflinlgeltktaillklllsal.gfkkkslagtidalrklltealgktdrptvlvlddidlldn
00527261   1/1  kgyvdleellrelaeelgellellkkllkklsellglsilglelilglsggdleelleelaellkklgkp
00470731   1/1  ilidg.........ddlrekavgeleklgrdlfqvaregglvpdilfideidallrkgpdvildgagrtp


                         -         *         -         -         -         -         +:350
query           DVRIIAASKGDMEALVAQGTFRQDLLYRLNVVTIPLPPLRERREDIVPLFEHFMLVAAVRYQRPAPILSE
00416171   1/1  dvrliaatnpdllelvlegelrpaLldRfdvieldlpsleerleilelllelllkrlaarlgleglelsd
00444381   1/1  vsregvqnaLlrlleegellitggggrikvfsnvtviaatnrlfigggaflgleelverllglnligfga
00418301   1/1  dvlnaLlrlleegeltilgggvdlp.nvlviaatnpdly...rpdeldpallrRfdlvielplpdleerl
00397131   1/1  .pvdvrlilatnr.ldklveagkfrkdlyyrlvvvplklpplrerpewikllaklf...........gle
00476651   1/1  .......ppsnvrvilttn.......rpekldpallsRflvielpppsleerleilklllekl.......
00402381   1/1  lggrivdlpnvrviaatnpgleelvklllgflaellkreveyagrgelppalldRfdliiefdppdleel
00462581   1/1  rlplkrqaggdllrallealltlldglislpsnvrviaatnr.pee......ldpasllrRfdviielpl
00402371   1/1  eeg.............nvrviaatnrp..elvklgeldpallrRfdvielplpdleerleilklllekll
00435251   1/1  ----------------------------------------------------------------------
00494911   1/1  .lpsnvrviattnrpel.......ldpallsRflvielpppsleerleilklllekl...........gl
00490531   1/1  gsggspdvqnaLlrlle.............rgnvrvIaat..nrpellk.feldpallrRflvielpppd
00379961   1/1  dpevqaaLlrlleegevtieragitlllpagvtviaatnddlg......eldpalldRfdlv.ielgplr
00430121   1/1  lggrvvdlsnviviattnpglegivellldllllgrlrelvedelrdrldpallrRfdrviefpppdeee
00474201   1/1  lle...........elpsnvrviattnrpl.......eldpallsRflvielpppdleerleilklllek
00367291   1/1  aLlrlleelrv.........lsgvlviattnr.......peeldpallrpgRfdlvielplpdleerlei
00368501   1/1  lggllteavlealriklvegelgfrelerevlldlplhdasviallgggrelrdgellkalkeaeaeell
00489971   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00379261   1/1  lggllteavrrlpysvllldelekahrpirvlllsaslvlllgglglpevgelllellddvgltdllgrt
00515731   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00497571   1/1  .pfirvn.......................nlrdlfelar..dpgilflDE.dklapdrq----------
00484651   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00521551   1/1  lnaLlrllegle.........dlsnvlviaat.nrpe......eldpallrpgRfdlvielplpdleerl
00503421   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00406781   1/1  lnaLlrlleelr.........llsgvtviattn.dle......eldpallrpgrfdrvielplpdleerl
00513861   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00420941   1/1  vlnaLlrlldglq.........alsnvtviatt.nrpee......ldpallrpgRfdlviefplpdeeer
00404191   1/1  ..aergvtlilttnnrpeel...dqallrllsrldrvivldlppdleergeilkrlaekl..........
00473941   1/1  vvelllllpsgvlviaat.nrpel......ldpallsRfdlvielpppdleerleilkrllkke......
00392701   1/1  lnaLlrlleglr.........llsgvtviatt.nrpe......eldpallrpgrfdriieldlpdleerl
00394721   1/1  rlledg.............nvlviattnrp..ellgrleldpallr------------------------
00386741   1/1  teldglllpsgvlviattnrpel.......ldpallsRfdlvielpppdeeerleilkrllkke......
00437921   1/1  ..pagvtliltt.nrle......ellpallsrfdiiefkplseeelleilkrilee......egvklsde
00484401   1/1  ----------------------------------------------------------------------
00371761   1/1  ----------------------------------------------------------------------
00437901   1/1  allklldglr.........dlsgvliiltt.ndpe......eldpallrRfdiiefpppdeeelleilkr
00437941   1/1  .pk.gvtviltt.nrlee......ldpallsRfdviefpppdeeelleilklilkke............g
00503741   1/1  spdvlelLlrlleegkltdkl......lgltliltthdldlle....rladrllsrfngkgivielppls
00469071   1/1  ----------------------------------------------------------------------
00499521   1/1  ----------------------------------------------------------------------
00482661   1/1  lakalanel...ggpvielnas........eerlkdllerllg..........-----------------
00512891   1/1  dpdvleallelleelk..........rsgvtvilttn.dldel..eladria------------------
00468261   1/1  evlaaLldllddl..........seidcsgisfiltsnpsdl.....lrslspallsrlgvveielpayt
00527261   1/1  vililDEiqslldvsskelleaLlrlldeg...........k.nvt------------------------
00470731   1/1  eqlealldllee.........lgrpv.vviiltt..nrevlldralrRpgrllldep.e-----------


                         -         -         -         -         *         -         -:420
query           MQRQQLMQRPWPGNVRELRNAADRLVLGVPEGGHAGGKADPVDESTPLRERMERYERAVIADTLARTGGA
00416171   1/1  ealdllaeyswpgnvRelenlleraal-------------------------------------------
00444381   1/1  dvlsrlelslllllllvedllpgeldpallgRfdevielplpdleerleilklll---------------
00418301   1/1  eilklllerllkrlaallglkklglkl-------------------------------------------
00397131   1/1  ldddalelLasy.wegNlraleneleklalla--------------------------------------
00476651   1/1  ...glp.lsdealealael.sggnprellnlleralllaleel---------------------------
00402381   1/1  leilkrllkkllkrlgekv.vglelsde------------------------------------------
00462581   1/1  pldleerleilkll................lelsdealealarl.tpgkllyfnvrellnl---------
00402371   1/1  krl......glelsdea.lealaelsygl-----------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00494911   1/1  elsdealealael.spgnprellnllera-----------------------------------------
00490531   1/1  leerleilklllkkle.......lgegve-----------------------------------------
00379961   1/1  dr.eerleilrhllekearrlgflepv-------------------------------------------
00430121   1/1  lleilrlllkkllkrlalk..geglelsdealealaelaytyggsardllrllerallla----------
00474201   1/1  l...........glelsdealealael.spgnprellnlleral--------------------------
00367291   1/1  lklllekl............glssdeale-----------------------------------------
00368501   1/1  ellglkdlllrkpsqlSgGqkqRvalara-----------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00379261   1/1  vdfkntiiiltsnvgelsggqrqrval-------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00521551   1/1  eilkrllekl............glesd-------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00406781   1/1  eilklllekl............glesd-------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00420941   1/1  leilklllekl............gles-------------------------------------------
00404191   1/1  .glplsdevlellaert..gngreli--------------------------------------------
00473941   1/1  .....gvelddealellaela.ggsar-------------------------------------------
00392701   1/1  eilklllekl............gleld-------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00386741   1/1  .....glelddealealaela.egsprd------------------------------------------
00437921   1/1  alealaels......ggdpraalnlle-------------------------------------------
00484401   1/1  --------ldlPpellelpllllpslllsasvlellellaelllelglsdlldlaleevErelieaaLea
00371761   1/1  ----------llgnvrelenlveaavllsddplitplhlllelalalyladldglllndllelvldevEr
00437901   1/1  ileke...........glklddealealaels.egsprdllnlleraal.......--------------
00437941   1/1  lklddealellaelsggsprdalnlld-------------------------------------------
00503741   1/1  e..eelleilkkrlfeagvelvfddeal------------------------------------------
00469071   1/1  ----------------------------------sllllldlllglslkealeevErelilealert.gn
00499521   1/1  -----------------------------------llllellllllalllsleeverelilraleacggn
00482661   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00468261   1/1  e..edileiikrlleglklpsn.....fpevvieelvelaadvisdeyvnllvrdlldvisr--------
00527261   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VSQAADLLQVGKATLYDKIKRYGL----------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00397131   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00402381   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00490531   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00484401   1/1  tggnkteAAelLgisrntLyrKlke---------------------------------------------
00371761   1/1  elieraLeltggNqseaAelLGlsR---------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00469071   1/1  lskaAelLgisrstLyrKlkkygldk--------------------------------------------
00499521   1/1  vseaArlLgisrstLyrklkklgld---------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00468261   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------