[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF07164.1


[Show Plain Result]

## Summary of Sequence Search
   1::219
  18::215  2.9e-41 37.6% 0048997 00489971 1/1   like                                    
  26::219  2.5e-16 24.2% 0043525 00435251 1/1   like                                    
  16::172  1.6e-10 23.3% 0050342 00503421 1/1   like                                    
  23::159  2.4e-10 23.3% 0039925 00399251 1/1   like                                    
  25::161  3.8e-09 28.7% 0048066 00480661 1/1   like                                    
  29::152  9.2e-09 26.9% 0051574 00515741 1/1   like                                    
  28::152  9.6e-09 26.7% 0051573 00515731 1/1   like                                    
  28::168    2e-08 28.7% 0050341 00503411 1/1   like                                    
  27::159  3.5e-08 27.1% 0047753 00477531 1/1   like                                    
  26::166  5.9e-08 27.0% 0045700 00457001 1/1   like                                    
  25::153  9.7e-08 26.4% 0047555 00475551 1/1   like                                    
  29::152  1.8e-07 27.7% 0048463 00484631 1/1   like                                    
  27::166  3.3e-07 27.2% 0045682 00456821 1/1   like                                    
  28::152  3.4e-07 25.8% 0051386 00513861 1/1   like                                    
  21::158  3.7e-07 25.8% 0051860 00518601 1/1   like                                    
  27::152  3.7e-07 27.3% 0050964 00509641 1/1   like                                    
  23::152  6.6e-07 25.4% 0048705 00487051 1/1   like                                    
  26::162  7.2e-07 26.3% 0047296 00472961 1/1   like                                    
  29::172  8.9e-07 27.9% 0048975 00489751 1/1   like                                    
  28::153  1.1e-06 27.3% 0047799 00477991 1/1   like                                    
  26::152  1.2e-06 25.4% 0047867 00478671 1/1   like                                    
  27::151  1.3e-06 27.5% 0048231 00482311 1/1   like                                    
  29::169  1.3e-06 27.2% 0048465 00484651 1/1   like                                    
  28::150  1.5e-06 26.3% 0045852 00458521 1/1   like                                    
  26::152  2.8e-06 26.2% 0046294 00462941 1/1   like                                    
  28::152  3.5e-06 26.7% 0048129 00481291 1/1   like                                    
  27::155  4.4e-06 26.0% 0046299 00462991 1/1   like                                    
  27::158  4.4e-06 26.8% 0051318 00513181 1/1   like                                    
  27::153  4.5e-06 27.7% 0048685 00486851 1/1   like                                    
  28::145    6e-06 26.3% 0048656 00486561 1/1   like                                    
  28::151  1.1e-05 26.7% 0046428 00464281 1/1   like                                    
  28::150  2.4e-05 27.1% 0049456 00494561 1/1   like                                    
  28::148  3.4e-05 24.8% 0049761 00497611 1/1   like                                    
   1::219


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHRNQAPSMTRRHPPPSAVAPPATTSRSLRILLVRDPHEADPLNVETIRAGLAQAGFTEVQTVDADLRLP
00489971   1/1  -----------------ltllllknlrglrilvvdd....dplvrellrrlLerlgyevvaaadgeeale
00435251   1/1  -------------------------msglrvLvV....DDdplirellrrlLerlgyevvgtaadgeeAl
00503421   1/1  ---------------llllllsllllsglriLvV....dDdplirellarlLeklgyev...aadgeeal
00399251   1/1  ----------------------plslsglrvLvV....dDdplirellrrlLeklgylevvltaadgeea
00480661   1/1  ------------------------lrsklrilivdd....dpalrellrrlLeaegyq.vlvaesgeeal
00515741   1/1  ----------------------------lriLvvdD....dpllrellrllLeslgy.vvleaadgeeal
00515731   1/1  ---------------------------glriliVdD....dpllrellallLeklgy.vvltaadgeeal
00503411   1/1  ---------------------------glriLvVdD....dpllrellrllLeklgy.evltaadgeeal
00477531   1/1  --------------------------kglriLiVdD....dplirellrrlLeklgllyvvltaadgeea
00457001   1/1  -------------------------lsklriliVdD....dplirellrrlLeslgdlyvvltaadgeea
00475551   1/1  ------------------------llsglriLvVdD....dpllrellrllLeklgyevvleaadgeeal
00484631   1/1  ----------------------------lrilivdD....dpllrellallLeklgy.vvltaadgeeal
00456821   1/1  --------------------------kklriliVdD....dplirellrrlLeslgdlyvvleaadgeea
00513861   1/1  ---------------------------glrilvvdD....dpllrellallLeslgy.vvltaadgeeal
00518601   1/1  --------------------ealsslsglrilvV....dDdplvrellrrlLerlgy.evvtaadgeeal
00509641   1/1  --------------------------sglrilvVdD....dpllrellrllLeslgye.vltaadgeeal
00487051   1/1  ----------------------llllsglriLvVdD....dplirellallLeslgyevvltaadgeeal
00472961   1/1  -------------------------lsglriLiVdD....dplirellrrlLeklgllyevleaadgeea
00489751   1/1  ----------------------------lriliVdD....dplirellrllLerlgye.vltaadgeeal
00477991   1/1  ---------------------------glrilvvdD....dpllrellallLeklgy.vvltaadgeeal
00478671   1/1  -------------------------lsglrilvvdD....dpllrellallLeslgy.vvltaadgeeal
00482311   1/1  --------------------------sglrilvvdD....dpllrellallLeklgy.vvltaadgeeal
00484651   1/1  ----------------------------lriLiVdD....dplirellrllLeklgye.vltaadgeeal
00458521   1/1  ---------------------------glriLvVdD....dpllrellallLeslgy.vvltaadgeeal
00462941   1/1  -------------------------lsklriliVdD....dplvrellallLeslgy.vvltaadgeeal
00481291   1/1  ---------------------------glriLvvdD....dpllrellallLeklgy.vvltaadgeeal
00462991   1/1  --------------------------lllelsglrvLvV....dDnplnrellkalLeklgy.evltasn
00513181   1/1  --------------------------sglrilvVdD....dplirellrllLeslgye.vltaadgeeal
00486851   1/1  --------------------------sglrilivdD....dpllrellallLeslgy.vvltaadgeeal
00486561   1/1  ---------------------------glrilvvdD....dpllrellkllLeklgyevvlvaadgeeal
00464281   1/1  ---------------------------klrilivdD....dpllrellrllLeslgllyvvltaadgeea
00494561   1/1  ---------------------------klrilivdD....dpllrellallLeslgy.vvltaadgeeal
00497611   1/1  ---------------------------glrilivdD....dpllrellallLeklgyevvgeaadgeeal


                         -         -         *         -         -         -         -:140
query           DTITASQPDLVIIASESAARDTIEHVCVSTQHAPRPIVLFTDNDDAQRIKAALSAGITAYIVDGLRAERV
00489971   1/1  .....lrpdlvlldlrmpdmdglellallrelpdlpvivltayedpelleaaleagaldylvkPldpeeL
00435251   1/1  elleelppdlvllDirmPgmdGlellrrlrelpdipvillTayadeedavraleaGaddyltKPfdleeL
00503421   1/1  ellrelppdlvllDlmmPgmdGlellrrlrelpalpdipvillTalddeedrvraleaGaddyltKPfdp
00399251   1/1  lellrelgalaglelglrpdlvllDinmPgmdGlellrrlralpllpdipvivlTaladeedrvraleaG
00480661   1/1  elleehrpdlvlldlmlPgmdglellrqLreeglllPvilltardd...rvaaldagaddyltkPfllpv
00515741   1/1  ellrelrpdlvllDlmmPgmdGlellrrlrelpdipvivlTalddeedavraleagaddyllKPfdleeL
00515731   1/1  ellrelrpdlvllDimmPgmdGlellrrlrelpdipvillTaladeedavraleagaddyllKPfdleeL
00503411   1/1  ellrelrpdlvllDimmPgmdGlellrrlrelpllpdipvillTalddeedavraleagaddyltKPfdl
00477531   1/1  lellrellalgslerpdlvllDlnmPgmdGlellrrlrelpllpdipvivlTalddeedavraleagadd
00457001   1/1  lellrelrpdlvllDlmmPgmdGlellrrlrelpdipvivlTalddelledavraleagaddyllKPfdl
00475551   1/1  ellrelrpdlvllDlmmPgmdGlellrrlrelpllpdipvillTaladeedavraleagaddyllKPfdl
00484631   1/1  ellrelrpdlvllDimmPgmdGlellrrlrelpdipvillTalddeedavraleagaddyllKPfdleeL
00456821   1/1  lellrelrpdlvllDlmmPgmdGlellrrlrellpdipvivlTayddeedavraleagaddyllKpfdle
00513861   1/1  ellrelrpdlvllDlmmPgmdGlellrrlrelgpdipvivlTaladeedavraleagaddyllKPfdlee
00518601   1/1  ellrelppdlvllDlrmpgmdGlellrrlrellpdipvillTayadeedavraleagaddyllKPfdlee
00509641   1/1  elleelrpdlvllDimmPgmdGlellrrlrelpdipvillTaladeedavraleagaddyllKPfdleeL
00487051   1/1  ellrelppdlvllDlmmPgmdGlellrrlrelpllpdipvillTaladeedavraleagaddyllKPfdl
00472961   1/1  lellrellelgdllrpdlvllDlnmPgmdGlellrrlrelpalpdipvivlTalddeedavraleagadd
00489751   1/1  ellrelrpdlvllDirmPgmdGlellrrlrelgpdlpvillTayddeedavraleagaddyllKPfdlee
00477991   1/1  ellrelppdlvllDimmPgmdGlellrrlrelgpdipvillTaladeedavraleagaddyllKPfdlee
00478671   1/1  ellrelrpdlvllDlrmPgmdGlellrrlrellpdlpvillTaladeedavraleagaddyllKPfdlee
00482311   1/1  ellrelrpdlvllDimmPgmdGlellrrlrelgpdipvillTalddeedavraleagaddyllKPfdlee
00484651   1/1  elleelrpdlvllDlmmPgmdGlellrrlrelgpdipvillTayadeedavealeagaddyllKPfdlee
00458521   1/1  ellrelrpdlvllDlmmPgmdGlellrrlrellllpdipvillTaladeedavraleagaddyllKPfdl
00462941   1/1  ellrelrpdlvllDlrmPgmdGlellrrlrellpdipvillTayddeedavealeagaddyllKPfdlee
00481291   1/1  ellrelrpdlvllDimmPgmdGlellrrlrelpalpdipvillTaladeedavraleagaddyllKPfdl
00462991   1/1  geealell.elppdlvllDiqmPgmdGlellrrirelellpllpdipiialtayadeedreraleagadd
00513181   1/1  ellrelrpdlvllDirmPgmdGlellrrlrellpdipvillTayddeedavraleagaddyllKPfdlee
00486851   1/1  elle...pdlvllDilmPgmdGlellrrlrellpdipvillTalddeedavealeagaddyllKPfdlee
00486561   1/1  ellrellesglrpdlvllDilmPgmdGlellrrlrelllpdipvillTaladeedavraleagaddyllK
00464281   1/1  lelleelrpdlvllDimmPgmdGlellrrlrelplpdipvivlTaladeedavraleagaddyllKPfdl
00494561   1/1  ellrelrpdlvllDllmPgmdGlellrrlrellpdipvillTayadledavraleagaddyllKPfdlee
00497611   1/1  ellrelrpdlvllDllmPgmdGlellrrlrellpdlpvivlTaladeedavealeagaddyllKPfdlee


                         +         -         -         -         -         *         -:210
query           KTVLDVAYARFQLDQQLRAELDATKLKLAERKTVERAKGLLMQARGISEDEAFKRLRSMAMERGIRLVDA
00489971   1/1  laalelalarfrrlrrlreelakleekleerklierakgllmkrrglseeeAyrllrklAmdsgtsleev
00435251   1/1  laalrralerrrllrelrlllellelllelrlllldallllliglslallellallrklilgesgtgkel
00503421   1/1  eeLlarirallrrrrllrelllllellellll--------------------------------------
00399251   1/1  addyllKPfdleeLlaair---------------------------------------------------
00480661   1/1  dqleeLlaridaalrrfllla-------------------------------------------------
00515741   1/1  laalrallrrlr----------------------------------------------------------
00515731   1/1  laalrallrrlr----------------------------------------------------------
00503411   1/1  eeLlarirallrrlrllsellllleele------------------------------------------
00477531   1/1  yllKPfdleeLlaairall---------------------------------------------------
00457001   1/1  eeLlaairallrrlrllsellallll--------------------------------------------
00475551   1/1  eeLlaalrallrr---------------------------------------------------------
00484631   1/1  laalrallrrlr----------------------------------------------------------
00456821   1/1  eLlaairallrrlrllsellaellle--------------------------------------------
00513861   1/1  Llaalrallrrl----------------------------------------------------------
00518601   1/1  Llaalrallrrlrllle.----------------------------------------------------
00509641   1/1  laalrallrrrr----------------------------------------------------------
00487051   1/1  eeLlaalrallr----------------------------------------------------------
00472961   1/1  yltKPfdleeLlaairallrrl------------------------------------------------
00489751   1/1  Llaairallrrlrllrellllllllellldll--------------------------------------
00477991   1/1  Llaalrallrrlr---------------------------------------------------------
00478671   1/1  Llaairallrrl----------------------------------------------------------
00482311   1/1  Llaalrallrr-----------------------------------------------------------
00484651   1/1  Llaairallrrlrllrelllllellelll-----------------------------------------
00458521   1/1  eeLlaairal------------------------------------------------------------
00462941   1/1  Llaairallrrl----------------------------------------------------------
00481291   1/1  eeLlaalrallr----------------------------------------------------------
00462991   1/1  yltKPvsleeLlaal-------------------------------------------------------
00513181   1/1  Llaairallrrlrllsen----------------------------------------------------
00486851   1/1  Llaairallrrlr---------------------------------------------------------
00486561   1/1  Pfdle-----------------------------------------------------------------
00464281   1/1  eeLlaalrall-----------------------------------------------------------
00494561   1/1  Llaalrallr------------------------------------------------------------
00497611   1/1  Llaalral--------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AQRVIDVMA-------------------------------------------------------------
00489971   1/1  Aeaii-----------------------------------------------------------------
00435251   1/1  varalhrls-------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------